KEGG   Mus musculus (mouse): 16336Help
Entry
16336             CDS       T01002                                 

Gene name
Insl3, Rlf, Rlnl
Definition
(RefSeq) insulin-like 3
  KO
K21999  insulin-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04926 Relaxin signaling pathway
    16336 (Insl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin Ins_beta
Motif
Other DBs
NCBI-GeneID: 16336
NCBI-ProteinID: NP_038592
MGI: 108427
Ensembl: ENSMUSG00000079019
Vega: OTTMUSG00000021110
UniProt: Q5RL10
Position
8 B3.3; 8 34.43 cM
AA seq 122 aa AA seqDB search
MRAPLLLMLLALGSALRSPQPPEARAKLCGHHLVRTLVRVCGGPRWSPEATQPVETRDRE
LLQWLEQRHLLHALVADVDPALDPQLPLQASQRQRRSAATNAVHRCCLTGCTQQDLLGLC
PH
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgccgctgctactgatgctcctggctctggggtccgcgctgcgctccccgcag
ccccccgaggcacgcgccaagctctgcggccaccacctggtgcgcacgctggtgcgggtg
tgcggcggcccacgctggtcgcccgaggccacgcagcctgtggagacccgggaccgggag
ctgctgcagtggctagagcagagacatctcctgcacgcgctggtggccgacgtggaccca
gcgctagacccgcagcttcctctccaggcttctcagcgccagcgccgcagtgccgccacc
aacgctgtgcaccgctgctgtcttactggctgcacccagcaagacctgttgggtctgtgt
ccccactga

DBGET integrated database retrieval system