KEGG   Mus musculus (mouse): 16341Help
Entry
16341             CDS       T01002                                 

Gene name
Eif3e, 48kDa, Eif3s6, Int6, eIF3-p46, eIF3-p48
Definition
(RefSeq) eukaryotic translation initiation factor 3, subunit E
  KO
K03250  translation initiation factor 3 subunit E
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03013  RNA transport
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    16341 (Eif3e)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    16341 (Eif3e)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mmu03012]
    16341 (Eif3e)
   03051 Proteasome [BR:mmu03051]
    16341 (Eif3e)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16341 (Eif3e)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    16341 (Eif3e)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    16341 (Eif3e)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16341 (Eif3e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_N PCI CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 16341
NCBI-ProteinID: NP_032414
MGI: 99257
Ensembl: ENSMUSG00000022336
UniProt: P60229 Q3UIG0
Position
15 B3.2; 15 16.73 cM
AA seq 445 aa AA seqDB search
MAEYDLTTRIAHFLDRHLVFPLLEFLSVKEIYNEKELLQGKLDLLSDTNMVDFAMDVYKN
LYSDDIPHALREKRTTVVAQLKQLQAETEPIVKMFEDPETTRQMQSTRDGRMLFDYLADK
HGFRQEYLDTLYRYAKFQYECGNYSGAAEYLYFFRVLVPATDRNALSSLWGKLASEILMQ
NWDAAMEDLTRLKETIDNNSVSSPLQSLQQRTWLIHWSLFVFFNHPKGRDNIIDLFLYQP
QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY
VNFDFDGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFCRIHQCISINMLADKL
NMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM
NIEKKLNQNSRSEAPNWATQDSGFY
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtacgacctgactactcgcatcgcgcattttctggatcggcacctggtcttt
ccgcttcttgagtttctctctgtgaaagagatttataatgaaaaagaattattacaagga
aaattagatcttcttagtgataccaatatggtggattttgctatggatgtttacaaaaac
ctttattctgatgatatccctcatgctttgagagaaaaaagaaccacagttgttgcgcag
ctgaaacagctccaggcagaaacagaaccaatcgtgaagatgtttgaagatccagaaact
acaaggcagatgcagtcaaccagggatggcaggatgttatttgactacctggcagacaaa
catgggtttaggcaagagtacttagatacactctacagatacgcaaaattccagtatgag
tgtggaaattactctggagctgcagagtatctttacttctttagagttttggtcccagca
acagatagaaatgctttaagttcgctctggggaaaactggcctctgaaatcttaatgcag
aattgggatgcagccatggaagaccttactcgattaaaagaaaccatagacaataattct
gtgagttctccactccagtctcttcagcagcgaacatggctcattcattggtctctattt
gtttttttcaaccatccaaagggccgtgataacattattgatctcttcctttaccaacca
cagtatcttaatgcaattcagacaatgtgtccacatattctacgctatttgactactgcc
gtcataaccaacaaagatgtgcggaaacgccggcaggtgctgaaagatctggtgaaagtg
attcaacaggagtcttacacatataaagacccaattacagaatttgttgaatgcctatat
gttaactttgattttgacggggctcagaaaaagctgagagaatgtgaatcagtgctcgtg
aatgacttcttcctggtagcgtgtctggaggacttcattgagaatgcccgtctcttcata
tttgagacgttttgtcgtatccaccagtgtatcagcattaatatgttagcagacaaactg
aatatgactccagaagaagctgaaagatggattgtgaatttgattagaaatgcgaggttg
gatgccaagattgattctaaactaggtcatgtggtaatgggcaacaatgcagtctcgccc
taccagcaagtgattgaaaagaccaaaagcctttcttttagaagccaaatgttggccatg
aatatcgaaaagaaacttaatcagaacagtagatcagaggctcccaactgggcaacccaa
gactctggcttctattaa

DBGET integrated database retrieval system