KEGG   Mus musculus (mouse): 16362Help
Entry
16362             CDS       T01002                                 

Gene name
Irf1, AU020929, Irf-1
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04917  Prolactin signaling pathway
mmu05133  Pertussis
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    16362 (Irf1)
  Endocrine system
   04917 Prolactin signaling pathway
    16362 (Irf1)
 Human Diseases
  Infectious diseases
   05133 Pertussis
    16362 (Irf1)
   05160 Hepatitis C
    16362 (Irf1)
   05165 Human papillomavirus infection
    16362 (Irf1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    16362 (Irf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRF
Motif
Other DBs
NCBI-GeneID: 16362
NCBI-ProteinID: NP_001152868
MGI: 96590
Ensembl: ENSMUSG00000018899
Vega: OTTMUSG00000005648
UniProt: P15314 Q5SX13
Structure
PDB: 

Position
11 B1.3; 11 32.0 cM
AA seq 329 aa AA seqDB search
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQR
KERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDI
TPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMK
LFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
NMDSIMWMDSLLGNSVRLPPSIQAIPCAP
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcactcgaatgcggatgagaccctggctagagatgcagattaattccaaccaa
atcccagggctgatctggatcaataaagaagagatgatcttccagattccatggaagcac
gctgctaagcacggctgggacatcaacaaggatgcctgtctgttccggagctgggccatt
cacacaggccgatacaaagcaggagaaaaagagccagatcccaagacatggaaggcaaac
ttccgttgtgccatgaactccctgccagacatcgaggaagtgaaggatcagagtaggaac
aagggcagctctgctgtgcgggtgtaccggatgctgccacccctcaccaggaaccagagg
aaagagagaaagtccaagtccagccgagacactaagagcaaaaccaagaggaagctgtgt
ggagatgttagcccggacactttctctgatggactcagcagctctaccctacctgatgac
cacagcagttacaccactcagggctacctgggtcaggacttggatatggaaagggacata
actccagcactgtcaccgtgtgtcgtcagcagcagtctctctgagtggcatatgcagatg
gacattataccagatagcaccactgatctgtataacctacaggtgtcacccatgccttcc
acctccgaagccgcaacagacgaggatgaggaagggaagatagccgaagaccttatgaag
ctctttgaacagtctgagtggcagccgacacacatcgatggcaagggatacttgctcaat
gagccagggacccagctctcttctgtctatggagacttcagctgcaaagaggaaccagag
attgacagccctcgaggggacattgggataggcatacaacatgtcttcacggagatgaag
aatatggactccatcatgtggatggacagcctgctgggcaactctgtgaggctgccgccc
tctattcaggccattccttgtgcaccatag

DBGET integrated database retrieval system