KEGG   Mus musculus (mouse): 16362
Entry
16362             CDS       T01002                                 

Gene name
Irf1, AU020929, Irf, Irf-1
Definition
(RefSeq) interferon regulatory factor 1
  KO
K09444  interferon regulatory factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04917  Prolactin signaling pathway
mmu05133  Pertussis
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    16362 (Irf1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    16362 (Irf1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    16362 (Irf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16362 (Irf1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16362 (Irf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16362 (Irf1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    16362 (Irf1)
SSDB
Motif
Pfam: IRF IQCJ-SCHIP1
Other DBs
NCBI-GeneID: 16362
NCBI-ProteinID: NP_001152868
MGI: 96590
Ensembl: ENSMUSG00000018899
Vega: OTTMUSG00000005648
UniProt: P15314 Q5SX13
Structure
PDB: 
1IF1

Position
11 B1.3; 11 32.0 cM
AA seq 329 aa
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAI
HTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTRNQR
KERKSKSSRDTKSKTKRKLCGDVSPDTFSDGLSSSTLPDDHSSYTTQGYLGQDLDMERDI
TPALSPCVVSSSLSEWHMQMDIIPDSTTDLYNLQVSPMPSTSEAATDEDEEGKIAEDLMK
LFEQSEWQPTHIDGKGYLLNEPGTQLSSVYGDFSCKEEPEIDSPRGDIGIGIQHVFTEMK
NMDSIMWMDSLLGNSVRLPPSIQAIPCAP
NT seq 990 nt   +upstreamnt  +downstreamnt
atgccaatcactcgaatgcggatgagaccctggctagagatgcagattaattccaaccaa
atcccagggctgatctggatcaataaagaagagatgatcttccagattccatggaagcac
gctgctaagcacggctgggacatcaacaaggatgcctgtctgttccggagctgggccatt
cacacaggccgatacaaagcaggagaaaaagagccagatcccaagacatggaaggcaaac
ttccgttgtgccatgaactccctgccagacatcgaggaagtgaaggatcagagtaggaac
aagggcagctctgctgtgcgggtgtaccggatgctgccacccctcaccaggaaccagagg
aaagagagaaagtccaagtccagccgagacactaagagcaaaaccaagaggaagctgtgt
ggagatgttagcccggacactttctctgatggactcagcagctctaccctacctgatgac
cacagcagttacaccactcagggctacctgggtcaggacttggatatggaaagggacata
actccagcactgtcaccgtgtgtcgtcagcagcagtctctctgagtggcatatgcagatg
gacattataccagatagcaccactgatctgtataacctacaggtgtcacccatgccttcc
acctccgaagccgcaacagacgaggatgaggaagggaagatagccgaagaccttatgaag
ctctttgaacagtctgagtggcagccgacacacatcgatggcaagggatacttgctcaat
gagccagggacccagctctcttctgtctatggagacttcagctgcaaagaggaaccagag
attgacagccctcgaggggacattgggataggcatacaacatgtcttcacggagatgaag
aatatggactccatcatgtggatggacagcctgctgggcaactctgtgaggctgccgccc
tctattcaggccattccttgtgcaccatag

DBGET integrated database retrieval system