KEGG   Mus musculus (mouse): 16367Help
Entry
16367             CDS       T01002                                 

Gene name
Irs1, G972R, IRS-1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04722  Neurotrophin signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04935  Growth hormone synthesis, secretion and action
mmu04960  Aldosterone-regulated sodium reabsorption
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    16367 (Irs1)
   04022 cGMP-PKG signaling pathway
    16367 (Irs1)
   04151 PI3K-Akt signaling pathway
    16367 (Irs1)
   04152 AMPK signaling pathway
    16367 (Irs1)
   04150 mTOR signaling pathway
    16367 (Irs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16367 (Irs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16367 (Irs1)
   04923 Regulation of lipolysis in adipocytes
    16367 (Irs1)
   04920 Adipocytokine signaling pathway
    16367 (Irs1)
   04935 Growth hormone synthesis, secretion and action
    16367 (Irs1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    16367 (Irs1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16367 (Irs1)
  09149 Aging
   04211 Longevity regulating pathway
    16367 (Irs1)
   04213 Longevity regulating pathway - multiple species
    16367 (Irs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    16367 (Irs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16367 (Irs1)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16367 (Irs1)
   04931 Insulin resistance
    16367 (Irs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 16367
NCBI-ProteinID: NP_034700
MGI: 99454
Ensembl: ENSMUSG00000055980
Vega: OTTMUSG00000016464
UniProt: P35569 Q543V3
Position
1 C5; 1 42.0 cM
AA seq 1231 aa AA seqDB search
MASPPDTDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKAH
HDGAGGGCGGSCSGSSGVGEAGEDLSYDTGPGPAFKEVWQVILKPKGLGQTKNLIGIYRL
CLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVV
AQNMHETILEAMRAMSDEFRPRSKSQSSSSCSNPISVPLRRHHLNNPPPSQVGLTRRSRT
ESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHRGSSRL
HPPLNHSRSIPMPSSRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSPSDGGF
ISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGASTLAAPNGHYIL
SRGGNGHRYIPGANLGTSPALPGDEAAGAADLDNRFRKRTHSAGTSPTISHQKTPSQSSV
ASIEEYTEMMPAAYPPGGGSGGRLPGYRHSAFVPTHSYPEEGLEMHHLERRGGHHRPDTS
NLHTDDGYMPMSPGVAPVPSNRKGNGDYMPMSPKSVSAPQQIINPIRRHPQRVDPNGYMM
MSPSGSCSPDIGGGSSSSSSISAAPSGSSYGKPWTNGVGGHHTHALPHAKPPVESGGGKL
LPCTGDYMNMSPVGDSNTSSPSECYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEPEEGAR
HQHLRLSSSSGRLRYTATAEDSSSSTSSDSLGGGYCGARPESSLTHPHHHVLQPHLPRKV
DTAAQTNSRLARPTRLSLGDPKASTLPRVREQQQQQQSSLHPPEPKSPGEYVNIEFGSGQ
PGYLAGPATSRSSPSVRCPPQLHPAPREETGSEEYMNMDLGPGRRATWQESGGVELGRIG
PAPPGSATVCRPTRSVPNSRGDYMTMQIGCPRQSYVDTSPVAPVSYADMRTGIAAEKASL
PRPTGAAPPPSSTASSSVTPQGATAEQATHSSLLGGPQGPGGMSAFTRVNLSPNHNQSAK
VIRADTQGCRRRHSSETFSAPTRAGNTVPFGAGAAVGGSGGGGGGGSEDVKRHSSASFEN
VWLRPGDLGGVSKESAPVCGAAGGLEKSLNYIDLDLAKERSQDCPSQQQSLPPPPPHQPL
GSNEGNSPRRSSEDLSNYASISFQKQPEDRQ
NT seq 3696 nt NT seq  +upstreamnt  +downstreamnt
atggcgagccctccggataccgatggcttctcagacgtgcgcaaggtgggctacctgcgc
aagcccaagagtatgcataagcgctttttcgtgctgcgggcggccagcgaggccgggggc
ccagcgcgcctggagtattatgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatccccctcgagagctgtttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgaacactttgccattgccgcggatagcgag
gctgagcaagacagctggtaccaggctcttctgcagctgcataatcgggcaaaggcccac
catgacggggctggaggaggctgcggcggtagctgcagcggcagctctggcgttggagag
gcaggggaggacttgagctatgacacgggtccaggacccgcgttcaaggaggtctggcag
gttatcctgaaacccaagggcctgggtcagacaaagaacctgattggcatctaccgcctc
tgcctgaccagcaagaccatcagctttgtgaagctgaactccgaggcagccgctgtggtg
ctgcagctgatgaatatcagacgctgtggccactcagagaacttcttcttcatcgaggtg
gggcgttccgctgtgacagggcctggcgagttctggatgcaagtggatgactccgtggtg
gcccagaacatgcatgagaccattctagaggcaatgagggccatgagcgatgagtttcgc
cctcgcagcaaaagccagtcttcatccagttgctccaaccccatcagcgttcccctgcgc
aggcaccatctcaacaaccctccacccagccaggtgggactgactcggagatctcgaact
gagagcatcactgccacctcccctgccagtatggtgggtgggaaaccaggttccttccgg
gtgcgtgcctccagcgatggcgaaggcaccatgtcccgtccagcatcagtggatggcagt
cctgtgagccctagcaccaacaggacccacgcccatcggcatcgaggcagctccaggctg
caccccccactcaaccacagccgctccatccccatgccttcttctagatgctcaccttca
gccaccagcccagtgagtctgtcatctagtagtaccagtggccatggctccacttcagac
tgtctcttcccgaggcgctctagtgcttccgtgtccggttcgcctagcgatggcggtttc
atctcttctgatgagtatggttctagtccctgcgatttccgaagttccttccgcagtgtc
accccagattccctggggcacaccccaccagccaggggtgaggaggagctgagcaattat
atctgcatgggtggcaagggagcctccaccttggctgctcccaatggccactacattttg
tctaggggtggcaacggccatcgctacatcccaggtgctaacttggggacaagcccagcg
ctgcctggagatgaagccgcgggtgcagcagatctggataaccggtttcgaaagagaact
cactccgcaggcacatctcctaccatttcccatcagaagaccccctcacagtcttcagtg
gcttctattgaggaatatacagagatgatgcccgctgcctacccaccaggaggtggcagt
ggaggccgactgcccggctaccggcattccgccttcgtgcccacccactcctatcccgaa
gagggtctagagatgcaccacttggaacgtcgtggaggccaccaccgtccagacacctcc
aacctccacactgatgatggctatatgcccatgtctcctggggtggctccagtgcccagc
aaccgcaaaggaaatggggactatatgcccatgagccccaagagtgtatctgccccacag
cagatcattaaccccatcagacgccacccacagagagtggaccccaatggctacatgatg
atgtcacccagtggtagttgctcccctgacattggaggtgggtccagcagcagtagcagc
atcagcgcagccccttctgggagcagctatgggaagccatggacaaatggagtagggggg
caccatactcatgcccttcctcatgccaaacctcctgttgagagtggtggcggtaagctc
ttgccttgcacaggtgactacatgaacatgtccccagtgggagattccaacaccagcagc
ccctcagaatgctactatggcccagaagatccccagcacaagccggtcctctcttactac
tcattgccaaggtcctttaagcacacccagcgccctggagagccagaggagggtgccagg
caccagcatcttcgtctctcttctagctctggacgccttcgctataccgcaactgccgaa
gattcctcctcttctaccagcagcgacagtctgggtgggggttactgtggggctaggcca
gagtcaagcctcacacatccccaccaccatgtcttgcagccccacctgcctcgaaaggta
gacacagctgcacagaccaacagccgcctggctcgacccacaaggctgtccttgggggat
cccaaggcaagcaccttaccccgggttcgagagcagcaacagcagcagcagtcttccctg
caccctcccgagcccaaaagcccaggagaatatgtgaatattgaattcgggagcggccag
cctggctatttagctggccctgcaacttcccgtagctctccttcagttcgatgtccaccc
cagctccacccagctcctagagaagagactggctcggaagagtacatgaacatggacttg
gggccaggccggagggcaacctggcaggagagtggtggagttgagttgggcagaataggc
cctgcacctccggggtctgctacggtttgcaggccaacccgttcggtgccaaatagccgt
ggtgactacatgaccatgcagataggttgtcctcgtcaaagctatgtggatacctcacca
gtggccccagtcagctatgctgacatgcggacaggcattgctgcagagaaggcgagcctg
cctagacccacaggagctgctcctcctccatcctccacagcctcttcttctgttacacct
caaggagccaccgctgagcaagctactcactcttccttgctgggaggccctcagggacct
gggggcatgagtgcattcaccagggtgaacctcagtcccaaccataaccagagtgccaaa
gtgattcgcgcagacactcaagggtgccggaggaggcatagctctgagaccttctcagca
cctactcgggctggcaatacggtgccctttggagcaggggctgcagtagggggcagcggc
ggtggtggtggtggcggcagtgaggatgtaaaacgccacagctctgcatcctttgagaat
gtgtggctgagacctggggatctagggggagtctccaaggagtcggctccagtgtgtggg
gctgctgggggtttggagaagagtcttaactacatagacctggatttggccaaggagcgc
tctcaggactgcccctctcaacagcagtccctaccaccccctccccctcaccagccctta
ggcagcaatgagggcaactccccaagacgctccagtgaggatttaagcaactatgccagc
atcagcttccagaagcagccagaggatcgtcaatag

KEGG   Mus musculus (mouse): 16369Help
Entry
16369             CDS       T01002                                 

Gene name
Irs3, AA408304
Definition
(RefSeq) insulin receptor substrate 3
  KO
K17445  insulin receptor substrate 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    16369 (Irs3)
   04022 cGMP-PKG signaling pathway
    16369 (Irs3)
   04152 AMPK signaling pathway
    16369 (Irs3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16369 (Irs3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16369 (Irs3)
   04923 Regulation of lipolysis in adipocytes
    16369 (Irs3)
   04920 Adipocytokine signaling pathway
    16369 (Irs3)
   04935 Growth hormone synthesis, secretion and action
    16369 (Irs3)
  09149 Aging
   04211 Longevity regulating pathway
    16369 (Irs3)
   04213 Longevity regulating pathway - multiple species
    16369 (Irs3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16369 (Irs3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 16369
NCBI-ProteinID: NP_034701
MGI: 1194882
Ensembl: ENSMUSG00000047182
Vega: OTTMUSG00000054603
UniProt: O54718
Position
5; 5 G2
AA seq 495 aa AA seqDB search
MKPAGTGPTVSSGGECTDVSLGSPFPWPCLPDVRLCGHLRKQKSQRRRFFVLRADPPRLE
CYESEKKFLASGCRPPRPRRTVSLEGACTISKRADARQRHLIVIYTSDSSLGVAAASEAE
QQAWYSALLEVRATAAAAAATAMGFSPQEAPESWIFAPFQDVWPVTLRSKGLGRAQGLSS
GSYRLCLGSGALSLLRKPGSKGSRDSRATPPPVLRLSLLSVRRCGHADSFFFLELGRSAP
IGPGELWLQAPDAVVAQSIHETVLAAMKRLGSNAAGKAEPPPQGNPPKSVPAAPTPTPYE
IPASAAQARSPSERAKQDYFKPLERMGSTHSYKGLDLGGNYITMGVRNDYVHMGGGEAGD
YMWMAPPGLPPTPARADPNKQLEDCESTEYVPMNRFLPGPFYYELKARESELGHPGAHCS
LRDRWRPTVAQPRSSQGSELSGDYMSIPDYVGTDSARLGSLDSCLNYVDLDLVPPLEVPG
AAPGKSPHSYASIKF
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgcaggtacgggccccacagtctcctccgggggcgagtgcaccgacgtgtcc
ctcggctcaccgtttccttggccctgcctgcccgacgtgcggctctgtggccatctgagg
aagcagaagtcccagcgccgccgctttttcgtgctgcgcgctgacccaccacgcctggag
tgctacgagagcgagaagaagttcttggccagcggctgccgcccacctagaccccggcgt
accgttagcctggagggtgcctgcactattagcaagcgcgcggatgcccgtcagcgccac
ctgatcgtcatctataccagcgacagcagcctgggcgtggcggcggccagcgaagcagag
cagcaagcatggtacagcgccctgctcgaggtgcgcgccaccgccgcagccgctgctgct
actgctatgggtttcagtccccaagaggcccctgagtcttggatcttcgccccattccag
gacgtctggcctgtgacactgcggtccaaggggctggggagagcacaaggcctgagcagc
ggcagctatcgcctgtgcctgggttctggggccctgagcctcctgcgaaagcctggaagc
aaaggttccagagacagccgggcaacgccaccaccagtcctgcgcttgtccttgctcagt
gtgcgccgctgtggccacgcagactcttttttcttcctggaactcgggcgctcagcgccc
attggtcctggtgagctctggctgcaggctcctgatgcagtggtggcccaaagcattcat
gagacagtcctggctgccatgaagcggctggggagcaatgcagctggcaaagctgagcca
ccgccacagggaaatcctccaaagagtgttcctgcagctcctaccccgacaccatatgaa
atccctgcatcggcagcacaagcaagaagccccagtgagcgagcaaagcaggactacttc
aagcccctggaaaggatggggtcaacacactcctacaagggactagatctgggcgggaac
tacatcaccatgggagtcaggaatgactatgtccacatggggggaggagaagcaggtgac
tatatgtggatggcgcccccaggccttcctcccacccctgccagggcagatcctaataag
cagctcgaggattgtgagagcacagagtatgtgcccatgaatagatttttacctgggcct
ttttactacgagctcaaggccagggagtctgaacttgggcatccgggtgcccattgtagc
cttagagacagatggagacccacagtggctcagccccgctcttcccaagggtcagagctc
tctggggactacatgtccatccccgactatgtaggaacggacagtgctaggctggggtct
ctggacagctgcctcaactatgtggacctggacctggtccctcccctggaggttcctgga
gcagccccagggaagagtccacatagctatgccagcatcaagttctag

KEGG   Mus musculus (mouse): 16370Help
Entry
16370             CDS       T01002                                 

Gene name
Irs4, IRS-4
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    16370 (Irs4)
   04022 cGMP-PKG signaling pathway
    16370 (Irs4)
   04152 AMPK signaling pathway
    16370 (Irs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16370 (Irs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16370 (Irs4)
   04923 Regulation of lipolysis in adipocytes
    16370 (Irs4)
   04920 Adipocytokine signaling pathway
    16370 (Irs4)
   04935 Growth hormone synthesis, secretion and action
    16370 (Irs4)
  09149 Aging
   04211 Longevity regulating pathway
    16370 (Irs4)
   04213 Longevity regulating pathway - multiple species
    16370 (Irs4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16370 (Irs4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH_11 PH_8
Motif
Other DBs
NCBI-GeneID: 16370
NCBI-ProteinID: NP_034702
MGI: 1338009
Ensembl: ENSMUSG00000054667
Vega: OTTMUSG00000019737
UniProt: Q9Z0Y7
Position
X F2; X 62.43 cM
AA seq 1216 aa AA seqDB search
MASCSFSGHQALRRLRASAAAAASAALAAVATTPLLSSGTRTALIGTGSSCPGAMWLSTA
TGSRSDSESEEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYRNARKFR
HSVRAAAAAAEAAASGAAVPALIPPRRVIILYQCFSVSQRADARYRHLIALFTQDEYFAM
VAENESEQESWYLLLSRLILESKRRRCGTLGALPDGEPAALAAAAAAEPPFYKDVWQVVV
KPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRS
TVIGPGELWMQVDDSVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSTRR
HLGLLPLEPGGWLRRYGLEQFCRLRAIREREEMLFTRRFISPREPPPPFRRGRGHLPRAR
RSRRAASVPPSLFRRSAPSPGRIPQPEDVPNDRAREASGSSSGNTEEKDKEGEEGNRGDC
IPMNNWGSGNGRGSGGGRGSSGQGSSSQGSGGRQGSGGGQGSGGQGAGGNQCSGNGQGTA
GGHGSGGGGHGSGGGQRPGDGHGSGGGKNSGSGKNSDDGDRGKSVKKRSYFGKFTQSKQQ
QTLPPPPPPPPAAGATGGKGKSGGRFRLYFCADRGTKERKEAKEVRDMETSGGATRGPYR
ARAFDEDEDDPYVPMRPGVAAPLACSSDYMPMAPQNSSASTKRHSRSPFEDSRGYMMMFP
RVSPPPPVPSAPKAPDTNKGDDSKDNDSDSDYMFMAPGAGAIPKNPPNAQGGSSSKSWSS
YFSLPSPFQSSPLGQSDHSEYVPMLPGKFLGSGLHKEASFSQGTKNVSSKPSTEASFSKP
EDKGSSAKPSDDVPPMNKAKEPNHLSFIAKGTQVKPKPLNPTQERREAAGSRDYINIDFI
KRERLVLPSSAQGLPDMRGVVTDPAPTAFSGYLNVEFGVPFPNPTIRLSDLLRVLPGANS
IPLAGTRWPFPGSAIGSIVEAGEYIEVIFNPAMTPAMSFADSAICYDAQTGQIYVVDPFS
ECCMDVSLSPGRCSEPPPVARLRREEAQERRRPQSRSQSLFASTRAAVSAFPTDSLDRDF
PAASAVIAAPAEAPLLAVSRALAVVSALAAAPSIGDVFAGFRAAAGVDSASARGFQPVAG
AQAVREFQDLAAGWNPGALNHRARGEDLAAGAAAPPPPPRQIWVLRPQERADSEDDDDDD
DDIYVRMDFARRDYRK
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgctccttctctggccaccaagcgcttaggagactgagagcctcagcagca
gcagcagcctccgcagctctagcagcagtggcgaccaccccgctcctttcctcgggaacc
cggaccgcactcattgggaccgggtcgtcctgtccgggagccatgtggctctccacagcc
actggctcccggtcagactcggaatccgaagaggaggacctccccgtcggggatgaagtc
tgcaaacgcggctacctgaggaagcagaagcatgggcataggcgttacttcgtgctcaaa
ctcgagaccgcagacgctccagctcgactcgaatactaccgaaatgccaggaagttccgg
cacagtgtccgcgccgcggcggctgcagcagaggcggccgcctccggtgctgcggtcccc
gcgctcatcccaccacggcgcgtgatcatcctgtaccaatgcttctccgtgagccagcgc
gccgatgccaggtaccgacacctcattgccctttttacccaggacgaatacttcgcgatg
gtggccgagaacgagtcggaacaagaaagctggtacttgctcctcagccgcctcatcctc
gagagcaagcgccgccgctgcggcacgctaggcgcactgccggacggagagccggcagcc
ctggcggccgcagcggcggcggagccacccttctacaaagatgtgtggcaggtagtagtg
aaacccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtcttacc
gacgaagaggtagtgtttgtaaggctcaataccgaagtggccagtgtggtcgtccagctg
ctgagcattcgtcgctgtgggcactcggagcagtacttcttcttggaagtcggcagatcc
actgtcataggtccgggggagctgtggatgcaagtggatgactccgtggtggcccaaaat
atgcatgagctgtttctggagaagatgagagccttgtgcgcagatgaatacagagcccga
tgccgcagctacagcatcagtattggcgcccacctgttaaccctgctgtccactaggagg
cacctgggcttgctcccgctggagcctggtggctggctcagaagatacggcttggagcag
ttttgccgcctcagagctatccgtgagagggaagagatgctattcaccaggcgcttcatc
tcacccagagagcctccgcctccctttaggcgaggaagagggcacctgcccagagcccgc
aggtccaggagagccgcgtcagtaccacccagccttttccgacgctcagcacctagcccg
ggaaggatcccacagcctgaagatgtccccaacgacagagcccgtgaagcctccggttcc
agctctggcaacactgaagaaaaagacaaggagggtgaggaaggaaaccgaggtgattgc
atacctatgaacaactggggctcaggaaatggccggggctcaggaggtggacggggctca
agtggccaaggttccagtagccagggctcaggtgggagacagggatctggaggtggccag
ggctcaggaggccagggtgccggaggaaaccagtgttcaggaaatggccagggcacagca
ggtggccatggctcaggtggaggtggccatggctcaggcggtggccagagacctggagat
ggtcatggctcaggtggtggcaagaactcaggaagtgggaaaaattctgacgatggtgac
cgtggaaaatctgtgaagaaaagatcctactttggtaaattcactcaaagcaagcagcag
caaacactgcctccacccccaccgccaccgccagcagctggagcaactggtggcaaaggg
aagtctggaggaagattccgactttatttttgcgcagacagaggcacaaaagaacgcaaa
gaagccaaagaggtaagagatatggagacctcaggaggtgctacccgggggccttacaga
gccagagctttcgatgaagatgaggatgacccgtatgtgccaatgagaccaggggtggct
gcccctcttgcgtgttccagtgattatatgccaatggctcctcaaaattcctctgcttca
acaaaacgccactctaggtcaccctttgaagactccagagggtacatgatgatgtttccc
agagtgagccccccaccacctgtgccaagtgctccgaaagcaccggacaccaataaaggg
gatgactcaaaggacaatgacagtgacagtgattacatgtttatggctcccggagcaggt
gcgattcctaaaaatcctcccaatgcgcagggaggctcttcctccaaaagctggagctcg
tatttctctctgccaagtccttttcagagttcacctttgggacagagtgaccacagtgag
tatgttcctatgttacctggaaaattcctggggagcggtctacacaaagaagcctccttt
agccagggcaccaaaaatgtgtcttcaaagccttcaactgaggcgtcattctcaaaaccc
gaagataaagggtcatctgcaaagccttcagatgatgtgcccccaatgaacaaggctaag
gaacctaaccacctttcttttattgcaaaaggaactcaagtaaagcccaaaccgctaaac
cccacacaggagcggagagaagctgctggctcccgtgactatatcaacattgactttatt
aagagagagcgccttgtgctaccttcctctgctcaaggactgccagacatgcggggcgta
gttactgaccccgcacccacagctttttctggctacctgaatgttgaattcggggtgccc
ttcccaaatccaacaatccgcctctcagatcttttaagagttctaccaggtgccaactcc
atccctctggccggtactaggtggcccttcccaggcagtgctataggtagcattgtggaa
gcgggagaatacattgaagttattttcaacccggctatgacaccagccatgtcttttgct
gacagtgccatttgctatgatgctcaaacaggtcaaatctatgtcgtcgacccattttct
gagtgctgtatggacgtttctctctctcctggtcgatgctctgaaccgccacctgtagct
aggctgcggcgggaggaagcgcaggagagaagacgcccacaaagccgctcccaaagttta
tttgccagcactcgagccgcggtctcggctttcccgactgacagcttggacagagacttt
cccgccgcttctgcggtgattgctgctccagctgaggcgcctctcttggcagtgagccgg
gctttagccgtggtctctgcgctcgcagcggcccccagcataggcgacgtctttgcaggc
ttccgcgctgcggcaggagttgactccgcctccgctcgcgggttccaacctgttgcgggt
gcccaggctgtaagagaattccaggaccttgccgcaggctggaatcctggagcccttaac
cacagggcccgaggtgaggacctggccgccggcgcagcggctcccccgccgccacctcgc
cagatttgggtgctgagaccccaagagagagcggattctgaggacgacgacgatgatgac
gacgacatttacgtgagaatggactttgccagacgagactacaggaagtga

KEGG   Mus musculus (mouse): 384783Help
Entry
384783            CDS       T01002                                 

Gene name
Irs2, Irs-2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04935  Growth hormone synthesis, secretion and action
mmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    384783 (Irs2)
   04022 cGMP-PKG signaling pathway
    384783 (Irs2)
   04152 AMPK signaling pathway
    384783 (Irs2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    384783 (Irs2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    384783 (Irs2)
   04923 Regulation of lipolysis in adipocytes
    384783 (Irs2)
   04920 Adipocytokine signaling pathway
    384783 (Irs2)
   04935 Growth hormone synthesis, secretion and action
    384783 (Irs2)
  09149 Aging
   04211 Longevity regulating pathway
    384783 (Irs2)
   04213 Longevity regulating pathway - multiple species
    384783 (Irs2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    384783 (Irs2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    384783 (Irs2)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    384783 (Irs2)
   04931 Insulin resistance
    384783 (Irs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH PH_11
Motif
Other DBs
NCBI-GeneID: 384783
NCBI-ProteinID: NP_001074681
MGI: 109334
Ensembl: ENSMUSG00000038894
Vega: OTTMUSG00000059106
UniProt: P81122
Position
8 A1.1; 8 5.35 cM
AA seq 1321 aa AA seqDB search
MASAPLPGPPASAGGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGTGGDEA
SAAGGSPPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLVSEGRSGEGGSGTTGGSCSASLPGVLGGSAGAAGCDDN
YGLVTPATAVYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLM
NIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEFRPR
SKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCTSCRVRT
ASEGDGGAAGGAGTAGGRPMSVAGSPLSPGPVRAPLSRSHTLSAGCGGRPSKVTLAPAGG
ALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPLPPGSHPHLPHPLHHPQGQRPSS
GSASASGSPSDPGFMSLDEYGSSPGDLRAFSSHRSNTPESIAETPPARDGSGGELYGYMS
MDRPLSHCGRPYRRVSGDGAQDLDRGLRKRTYSLTTPARQRQVPQPSSASLDEYTLMRAT
FSGSSGRLCPSFPASSPKVAYNPYPEDYGDIEIGSHKSSSSNLGADDGYMPMTPGAALRS
GGPNSCKSDDYMPMSPTSVSAPKQILQPRLAAALPPSGAAVPAPPSGVGRTFPVNGGGYK
ASSPAESSPEDSGYMRMWCGSKLSMENPDPKLLPNGDYLNMSPSEAGTAGTPPDFSAALR
GGSEGLKGIPGHCYSSLPRSYKAPCSCSGDNDQYVLMSSPVGRILEEERLEPQATPGAGT
FGAAGGSHTQPHHSAVPSSMRPSAIGGRPEGFLGQRCRAVRPTRLSLEGLQTLPSMQEYP
LPTEPKSPGEYINIDFGEAGTRLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSD
SRQRSPLSDYMNLDFSSPKSPKPSTRSGDTVGSMDGLLSPEASSPYPPLPPRPSTSPSSL
QQPLPPAPGDLYRLPPASAATSQGPTAGSSMSSEPGDNGDYTEMAFGVAATPPQPIVAPP
KPEGARVASPTSGLKRLSLMDQVSGVEAFLQVSQPPDPHRGAKVIRADPQGGRRRHSSET
FSSTTTVTPVSPSFAHNSKRHNSASVENVSLRKSSEGSSTLGGGDEPPTSPGQAQPLVAV
PPVPQARPWNPGQPGALIGCPGGSSSPMRRETSVGFQNGLNYIAIDVRGEQGSLAQSQPQ
PGDKNSWSRTRSLGGLLGTVGGSGASGVCGGPGTGALPSASTYASIDFLSHHLKEATVVK
E
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atggctagcgcgcccctgcctgggccccccgcgtcggcgggcggggacggcccgaacctc
aataacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcacggccacaagcgctttttcgtgttgcgcggccccggcacgggcggcgacgaggca
tccgcggctggggggtcgccgccgcagcctccgcggctggagtactacgagagcgagaag
aagtggaggagcaaggcgggcgcgccgaagcgagtgatcgcgctcgactgctgtctgaac
atcaacaagcgcgcggacgccaagcacaagtacctgatcgccctctacaccaaggacgag
tacttcgctgtagcggcggagaacgagcaggagcaggagggctggtaccgcgcactcacc
gacttggtcagcgaaggccgctctggcgaggggggctcgggcaccaccggaggctcttgc
agcgcctctctcccgggcgtcctgggcggctcagcgggcgccgctggctgcgatgacaac
tacgggctcgtgacacccgccacggccgtctaccgcgaggtgtggcaggtgaacctgaaa
cctaagggactgggccagagcaagaacctgactggtgtataccgcctatgcctgtctgcg
cgcaccatcggcttcgtgaagctcaattgcgaacagccgtcggtgacgctgcagcttatg
aacattcgccgctgcggccactcggacagcttcttcttcatcgaggtgggccgttcggcc
gtcaccggtcccggggagctgtggatgcaagccgacgactcggtggtggcgcagaacatc
catgagaccatcctagaagctatgaaggcactcaaagagctcttcgagttccggcctcgc
agcaagagtcagtcgtccgggtcgtcagccacgcatcccatcagcgtgccgggcgcgcgc
cgccaccaccacctagtcaacctaccccctagccagaccggcctggtgcgccgctcgcgc
actgacagcctggcggccacccccccagcagccaagtgcacttcgtgccgggttcgtacg
gccagcgagggcgacggcggcgcggcaggcggggccgggacggcaggaggcaggccgatg
tcggtggcagggagccccctgagtcccgggccggtgcgcgcgccccttagccgctcgcac
accctgagcgccggctgcggaggccgcccgagcaaagtgactctggcgccggcaggggga
gccctgcaacacagccgctccatgtccatgcccgtggcgcactcacctcctgcagccacc
agcccaggcagcctgtcctccagcagtgggcacggctcgggctcctacccgctgccacct
ggctcccacccgcacctgcctcatccactgcatcacccccaaggccagcgtccgtccagc
ggtagtgcctccgcctcgggctcccccagcgacccgggtttcatgtcccttgacgagtat
ggctccagccctggcgacctgagagccttcagtagccacaggagcaacacacccgagtca
atagcggagaccccgccagccagagatggcagtgggggcgaactctatgggtacatgagc
atggatagacccctgagccactgtggccgcccttaccgtagggtctcaggggatggggcc
caggacctggatagaggactgaggaagaggacttattccctaaccacgcctgccaggcag
cggcaggtacctcagccttcctctgcctctctagatgaatacactctcatgagggccacc
ttctctggtagttcaggtcgcctctgcccatccttccctgcgtcctctcccaaagtggcc
tacaacccttacccagaggactatggagacattgagattggttctcacaagagttccagc
agtaacctgggggcagatgatggctacatgcccatgacccctggggcagcccttaggagt
ggtggtcccaatagctgcaagagcgatgactacatgcccatgagccccacaagcgtgtct
gctcccaagcagatcctgcagccacgcttggcagcggccttgcccccttccggagcagcc
gtgccagcacccccttcaggggtgggcaggaccttcccagtaaacggaggtggctacaaa
gccagctccccagcggagagctccccagaagacagtgggtacatgcgaatgtggtgtggc
tccaagctgtctatggagaacccagaccctaagctactccccaacggggactacctcaac
atgtcccccagcgaggcaggcactgcagggaccccacctgacttctcagcagctttgcgt
ggaggcagtgaaggcctcaaaggcatcccgggccactgctacagctctttgccccgctct
tataaggctccctgttcctgcagcggagacaatgaccagtatgtgctcatgagctcccct
gtgggccggatcttggaagaggagagactggagccccaggccaccccaggggctggcacc
tttggggcagctggtggtagtcatacccagcctcatcactcagcagtgccttcctccatg
aggccgagtgccatcggtggccgccctgagggcttcctgggccagcgatgtcgggcagtg
cggcctacacgcctatcgctagagggactgcagacccttcccagcatgcaagagtaccct
ctacccacagagcccaagagccctggcgagtacatcaacattgactttggtgaggcaggt
acccgtctgtctccgcctgcccccccactactggcatccgcggcctcatcttcttcactg
ctctcagctagtagtcctgcttcatccctgggttcaggaaccccaggcaccagcagcgac
agccggcagcgctctccactctctgactatatgaacctggacttcagttctcccaagtcc
cccaagcctagcacccgcagtggggacacagtaggctccatggatggccttctctctcca
gaggcttcatccccatacccaccactgcccccacgtccttccacttccccttcctcctta
cagcagcctctgccacctgccccgggagacctataccgcctgcctccagcatcagctgcc
acttcccagggtcccactgctggctcctcaatgtcctccgagcctggggataatggtgac
tataccgagatggcctttggtgtggctgcaaccccgccacaacctatcgtggcacctcca
aagccagaaggtgcccgagtggccagtcccacatcgggcttgaagcggctaagtctcatg
gatcaggtatctggggtggaggctttccttcaagtcagccagccccctgacccccaccgg
ggtgctaaggtcatccgtgcagacccacaggggggacgtcgtcgccacagttcagagacc
ttttcctctaccaccaccgtcaccccagtgtccccatcctttgcccacaattccaagcgc
cacaattcggcctctgtggaaaatgtctcactcaggaaaagcagtgaaggcagcagtacc
ctgggaggaggtgatgagccgcccacatccccaggacaggcacagcccttggtggctgtg
cccccagtgccacaggctaggccgtggaaccccggtcagcccggagctttgattggctgt
cctggaggcagcagttctcccatgcgcagagagacctccgtgggtttccagaacggcctc
aactatatcgccatcgatgtgagaggcgagcaggggtccttggcgcagtctcagccgcag
ccaggagacaagaactcctggagccggacccgtagccttggggggctcctcggcaccgtc
ggaggctctggcgccagcggagtgtgtgggggtccaggcactggagctttgccctctgcc
agcacctatgcaagcatcgacttcctgtcccatcacttgaaggaagccacagtcgtgaaa
gagtga

DBGET integrated database retrieval system