KEGG   Mus musculus (mouse): 16370
Entry
16370             CDS       T01002                                 

Gene name
Irs4, IR, IRS-4
Definition
(RefSeq) insulin receptor substrate 4
  KO
K17446  insulin receptor substrate 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04068  FoxO signaling pathway
mmu04140  Autophagy - animal
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu04930  Type II diabetes mellitus
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    16370 (Irs4)
   04022 cGMP-PKG signaling pathway
    16370 (Irs4)
   04152 AMPK signaling pathway
    16370 (Irs4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    16370 (Irs4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    16370 (Irs4)
   04923 Regulation of lipolysis in adipocytes
    16370 (Irs4)
   04920 Adipocytokine signaling pathway
    16370 (Irs4)
   04935 Growth hormone synthesis, secretion and action
    16370 (Irs4)
  09149 Aging
   04211 Longevity regulating pathway
    16370 (Irs4)
   04213 Longevity regulating pathway - multiple species
    16370 (Irs4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    16370 (Irs4)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    16370 (Irs4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    16370 (Irs4)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   16370 (Irs4)
SSDB
Motif
Pfam: IRS PH_11 PH_8
Other DBs
NCBI-GeneID: 16370
NCBI-ProteinID: NP_034702
MGI: 1338009
Ensembl: ENSMUSG00000054667
Vega: OTTMUSG00000019737
UniProt: Q9Z0Y7
Position
X F2; X 62.43 cM
AA seq 1216 aa
MASCSFSGHQALRRLRASAAAAASAALAAVATTPLLSSGTRTALIGTGSSCPGAMWLSTA
TGSRSDSESEEEDLPVGDEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYRNARKFR
HSVRAAAAAAEAAASGAAVPALIPPRRVIILYQCFSVSQRADARYRHLIALFTQDEYFAM
VAENESEQESWYLLLSRLILESKRRRCGTLGALPDGEPAALAAAAAAEPPFYKDVWQVVV
KPRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRS
TVIGPGELWMQVDDSVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSTRR
HLGLLPLEPGGWLRRYGLEQFCRLRAIREREEMLFTRRFISPREPPPPFRRGRGHLPRAR
RSRRAASVPPSLFRRSAPSPGRIPQPEDVPNDRAREASGSSSGNTEEKDKEGEEGNRGDC
IPMNNWGSGNGRGSGGGRGSSGQGSSSQGSGGRQGSGGGQGSGGQGAGGNQCSGNGQGTA
GGHGSGGGGHGSGGGQRPGDGHGSGGGKNSGSGKNSDDGDRGKSVKKRSYFGKFTQSKQQ
QTLPPPPPPPPAAGATGGKGKSGGRFRLYFCADRGTKERKEAKEVRDMETSGGATRGPYR
ARAFDEDEDDPYVPMRPGVAAPLACSSDYMPMAPQNSSASTKRHSRSPFEDSRGYMMMFP
RVSPPPPVPSAPKAPDTNKGDDSKDNDSDSDYMFMAPGAGAIPKNPPNAQGGSSSKSWSS
YFSLPSPFQSSPLGQSDHSEYVPMLPGKFLGSGLHKEASFSQGTKNVSSKPSTEASFSKP
EDKGSSAKPSDDVPPMNKAKEPNHLSFIAKGTQVKPKPLNPTQERREAAGSRDYINIDFI
KRERLVLPSSAQGLPDMRGVVTDPAPTAFSGYLNVEFGVPFPNPTIRLSDLLRVLPGANS
IPLAGTRWPFPGSAIGSIVEAGEYIEVIFNPAMTPAMSFADSAICYDAQTGQIYVVDPFS
ECCMDVSLSPGRCSEPPPVARLRREEAQERRRPQSRSQSLFASTRAAVSAFPTDSLDRDF
PAASAVIAAPAEAPLLAVSRALAVVSALAAAPSIGDVFAGFRAAAGVDSASARGFQPVAG
AQAVREFQDLAAGWNPGALNHRARGEDLAAGAAAPPPPPRQIWVLRPQERADSEDDDDDD
DDIYVRMDFARRDYRK
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggcgagttgctccttctctggccaccaagcgcttaggagactgagagcctcagcagca
gcagcagcctccgcagctctagcagcagtggcgaccaccccgctcctttcctcgggaacc
cggaccgcactcattgggaccgggtcgtcctgtccgggagccatgtggctctccacagcc
actggctcccggtcagactcggaatccgaagaggaggacctccccgtcggggatgaagtc
tgcaaacgcggctacctgaggaagcagaagcatgggcataggcgttacttcgtgctcaaa
ctcgagaccgcagacgctccagctcgactcgaatactaccgaaatgccaggaagttccgg
cacagtgtccgcgccgcggcggctgcagcagaggcggccgcctccggtgctgcggtcccc
gcgctcatcccaccacggcgcgtgatcatcctgtaccaatgcttctccgtgagccagcgc
gccgatgccaggtaccgacacctcattgccctttttacccaggacgaatacttcgcgatg
gtggccgagaacgagtcggaacaagaaagctggtacttgctcctcagccgcctcatcctc
gagagcaagcgccgccgctgcggcacgctaggcgcactgccggacggagagccggcagcc
ctggcggccgcagcggcggcggagccacccttctacaaagatgtgtggcaggtagtagtg
aaacccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtcttacc
gacgaagaggtagtgtttgtaaggctcaataccgaagtggccagtgtggtcgtccagctg
ctgagcattcgtcgctgtgggcactcggagcagtacttcttcttggaagtcggcagatcc
actgtcataggtccgggggagctgtggatgcaagtggatgactccgtggtggcccaaaat
atgcatgagctgtttctggagaagatgagagccttgtgcgcagatgaatacagagcccga
tgccgcagctacagcatcagtattggcgcccacctgttaaccctgctgtccactaggagg
cacctgggcttgctcccgctggagcctggtggctggctcagaagatacggcttggagcag
ttttgccgcctcagagctatccgtgagagggaagagatgctattcaccaggcgcttcatc
tcacccagagagcctccgcctccctttaggcgaggaagagggcacctgcccagagcccgc
aggtccaggagagccgcgtcagtaccacccagccttttccgacgctcagcacctagcccg
ggaaggatcccacagcctgaagatgtccccaacgacagagcccgtgaagcctccggttcc
agctctggcaacactgaagaaaaagacaaggagggtgaggaaggaaaccgaggtgattgc
atacctatgaacaactggggctcaggaaatggccggggctcaggaggtggacggggctca
agtggccaaggttccagtagccagggctcaggtgggagacagggatctggaggtggccag
ggctcaggaggccagggtgccggaggaaaccagtgttcaggaaatggccagggcacagca
ggtggccatggctcaggtggaggtggccatggctcaggcggtggccagagacctggagat
ggtcatggctcaggtggtggcaagaactcaggaagtgggaaaaattctgacgatggtgac
cgtggaaaatctgtgaagaaaagatcctactttggtaaattcactcaaagcaagcagcag
caaacactgcctccacccccaccgccaccgccagcagctggagcaactggtggcaaaggg
aagtctggaggaagattccgactttatttttgcgcagacagaggcacaaaagaacgcaaa
gaagccaaagaggtaagagatatggagacctcaggaggtgctacccgggggccttacaga
gccagagctttcgatgaagatgaggatgacccgtatgtgccaatgagaccaggggtggct
gcccctcttgcgtgttccagtgattatatgccaatggctcctcaaaattcctctgcttca
acaaaacgccactctaggtcaccctttgaagactccagagggtacatgatgatgtttccc
agagtgagccccccaccacctgtgccaagtgctccgaaagcaccggacaccaataaaggg
gatgactcaaaggacaatgacagtgacagtgattacatgtttatggctcccggagcaggt
gcgattcctaaaaatcctcccaatgcgcagggaggctcttcctccaaaagctggagctcg
tatttctctctgccaagtccttttcagagttcacctttgggacagagtgaccacagtgag
tatgttcctatgttacctggaaaattcctggggagcggtctacacaaagaagcctccttt
agccagggcaccaaaaatgtgtcttcaaagccttcaactgaggcgtcattctcaaaaccc
gaagataaagggtcatctgcaaagccttcagatgatgtgcccccaatgaacaaggctaag
gaacctaaccacctttcttttattgcaaaaggaactcaagtaaagcccaaaccgctaaac
cccacacaggagcggagagaagctgctggctcccgtgactatatcaacattgactttatt
aagagagagcgccttgtgctaccttcctctgctcaaggactgccagacatgcggggcgta
gttactgaccccgcacccacagctttttctggctacctgaatgttgaattcggggtgccc
ttcccaaatccaacaatccgcctctcagatcttttaagagttctaccaggtgccaactcc
atccctctggccggtactaggtggcccttcccaggcagtgctataggtagcattgtggaa
gcgggagaatacattgaagttattttcaacccggctatgacaccagccatgtcttttgct
gacagtgccatttgctatgatgctcaaacaggtcaaatctatgtcgtcgacccattttct
gagtgctgtatggacgtttctctctctcctggtcgatgctctgaaccgccacctgtagct
aggctgcggcgggaggaagcgcaggagagaagacgcccacaaagccgctcccaaagttta
tttgccagcactcgagccgcggtctcggctttcccgactgacagcttggacagagacttt
cccgccgcttctgcggtgattgctgctccagctgaggcgcctctcttggcagtgagccgg
gctttagccgtggtctctgcgctcgcagcggcccccagcataggcgacgtctttgcaggc
ttccgcgctgcggcaggagttgactccgcctccgctcgcgggttccaacctgttgcgggt
gcccaggctgtaagagaattccaggaccttgccgcaggctggaatcctggagcccttaac
cacagggcccgaggtgaggacctggccgccggcgcagcggctcccccgccgccacctcgc
cagatttgggtgctgagaccccaagagagagcggattctgaggacgacgacgatgatgac
gacgacatttacgtgagaatggactttgccagacgagactacaggaagtga

DBGET integrated database retrieval system