KEGG   Mus musculus (house mouse): 16371
Entry
16371             CDS       T01002                                 
Symbol
Irx1
Name
(RefSeq) Iroquois homeobox 1
  KO
K24889  iroquois-class homeodomain protein IRX
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16371 (Irx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain TALE
    16371 (Irx1)
SSDB
Motif
Pfam: Homeobox_KN Homeodomain MRP-S32 Dicty_REP
Other DBs
NCBI-GeneID: 16371
NCBI-ProteinID: NP_034703
MGI: 1197515
Ensembl: ENSMUSG00000060969
UniProt: P81068
Position
13:complement(72106351..72111842)
AA seq 480 aa
MSFPQLGYPQYLSAAGPGAYGGERPGVLAAAAAAAAAASSGRPGTAELGAGAGAAAVTSV
LGMYAAAGPYAGAPNYSAFLPYAADLSLFSQMGSQYELKDNPGVHPATFAAHTTPAYYPY
GQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFAN
ARRRLKKENKVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDQIDERDGDQ
SNEDEEDKAEAPRARVAPPASARDQSSPLSAAETLKSQDSPLGLVKEVSEPGSTRLLSPG
AAAVGLQGAPHSKPKIWSLAETATSPDGAPKASPPPPSSHASAHGPPSGSPLQHPAFLPS
HGLYTCHIGKFSNWTNGAFLAQGSLLNMRSFLGVSAPHAAPHGPHLTAPPPPQPPVQVAT
GVLHGEKASARSSPALPERDLVTRPDSPPQQLKSPFQPVRDNSLAPQEGTPRILAALPSA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtccttcccgcagctgggctacccgcaatacctaagcgccgcgggcccgggcgcctat
ggtggagagcgccctggggtgctggctgcggccgcggctgctgcggccgccgcctcgtcg
ggccgtcccgggactgcggagctgggagcgggcgcgggagcggccgcggtcacctcggtg
ctaggcatgtatgccgcggcgggaccgtacgcgggcgcacccaactacagcgccttcttg
ccctatgccgcggacctcagcctcttctcgcagatgggctctcagtatgaactgaaggac
aaccccggggtgcacccagcgaccttcgcagcccacacaacgcctgcttattatccctat
ggtcagtttcaatacggggatcccggacggcccaagaacgccacgcgggagagcaccagc
acgctgaaagcctggctcaacgaacaccgcaagaacccgtaccccaccaaaggagagaag
attatgctggccattatcaccaagatgaccctcacacaggtctccacctggttcgccaat
gcgcgccggcgcctcaagaaggagaacaaggtgacttggggggcgcgcagcaaggaccag
gaagacggcgccctctttggcagcgacaccgagggcgaccccgagaaggccgaggacgac
gaggagatcgacctggagagcattgacatcgatcagatcgacgagcgtgatggcgaccag
agcaacgaagacgaagaggacaaggcggaggctcctagggcgcgcgtagcccctcccgcc
tcagctcgggaccagagctccccattgtcggctgctgagacactcaagtctcaagattcg
cccttgggcctggttaaggaggtctcagagcccggcagcacacgcctgctgagtcctggc
gccgcggcggtcggcctgcagggcgcgccgcacagcaagcccaagatctggtctctggct
gagacagccactagccccgatggtgcgcctaaggcgtctccaccgccaccctcaagccac
gccagcgcacacgggccgcccagcggctcacccctgcaacacccggcctttctacccagc
cacggactgtacacctgtcacataggcaagttttccaactggaccaacggcgcgttccta
gcacagggctcgctgctgaacatgcgatctttcctgggcgtcagcgcgccgcatgcagca
cctcacggcccacacctgacagcaccaccacctccacagccgccagtccaggttgccacc
ggggtgctccatggtgagaaggcctccgcacgcagcagtcctgcacttccagagagagac
ctagtcaccagaccggattcgcccccacaacagttaaagtcgcccttccagccggtgcgc
gacaactcgctggccccgcaggagggaacgcctcggatcctcgcagccctcccgtctgcc
tga

DBGET integrated database retrieval system