KEGG   Mus musculus (mouse): 16398
Entry
16398             CDS       T01002                                 

Gene name
Itga2, CD49B, DX5, GPIa
Definition
(RefSeq) integrin alpha 2
  KO
K06481  integrin alpha 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16398 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16398 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16398 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16398 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16398 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16398 (Itga2)
   04611 Platelet activation
    16398 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16398 (Itga2)
   05205 Proteoglycans in cancer
    16398 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16398 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16398 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16398 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16398 (Itga2)
   05414 Dilated cardiomyopathy
    16398 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16398 (Itga2)
   04515 Cell adhesion molecules [BR:mmu04515]
    16398 (Itga2)
   04090 CD molecules [BR:mmu04090]
    16398 (Itga2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   16398 (Itga2)
  Exosomal proteins of bladder cancer cells
   16398 (Itga2)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16398 (Itga2)
CD molecules [BR:mmu04090]
 Proteins
  16398 (Itga2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha DUF11 HisK_sensor
Other DBs
NCBI-GeneID: 16398
NCBI-ProteinID: NP_032422
MGI: 96600
Ensembl: ENSMUSG00000015533
UniProt: Q62469
Position
13 D2.2; 13 64.61 cM
AA seq 1178 aa
MGPGQAGGALLLRLLMLVQGILNCLAYNVGLPGAKIFSGPSSEQFGYSVQQLTNPQGNWL
LVGSPWSGFPENRMGDVYKCPVDLPTATCEKLNLQNSASISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQFLTSFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLVKFVTGLDIGPKKTQVALIQYANEPRIIFNLNDFETKEDMVQATSETR
QHGGDLTNTFRAIEFARDYAYSQTSGGRPGATKVMVVVTDGESHDGSKLKTVIQQCNDDE
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEQIFS
IEGTVQGGDNFQMEMAQVGFSADYAPQNDILMLGAVGAFDWSGTLVQETSHKPVIFPKQA
FDQVLQDRNHSSFLGYSVAAISTEDGVHFVAGAPRANYTGQIVLYSVNKQGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPTYMNDLKKEEGKVYLFTITKGILNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSNGAFRRHLQFFGRSLDGYGDLNGDSITDVSIGALGQVIQLWSQSIADVAIEALFTP
DKITLLNKDAKITLKLCFRAEFRPAGQNNQVAILFNMTLDADGHSSRVTSRGVFRENSER
FLQKNMVVNEVQKCSEHHISIQKPSDVVNPLDLRVDISLENPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVQQLPAIQTQSFIVSNQNKRLTFSVILKNRGESAYNTVVLA
EFSENLFFASFSMPVDGTEVTCEVGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFQAFSESQETNKADNSVSLTIPLLYDAELHLTRSTNINFYEISSDENAPSVIKS
VEDIGPKFIFSLKVTAGSAPVSMALVTIHIPQYTKEKNPLLYLTGIQTDQAGDISCTAEI
NPLKLPHTAPSVSFKNENFRHTKELDCRTTSCSNITCWLKDLHMKAEYFINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMTAGLWKLGFFKRQYKKMGQNPDEMDETTELNS
NT seq 3537 nt   +upstreamnt  +downstreamnt
atgggaccgggacaggcagggggcgcgctcctgctgcggctgctaatgctagttcaaggt
attttgaattgtctggcgtataatgttggcctcccaggagcgaaaatattttccgggcct
tcaagtgaacagtttgggtattcagtacagcagcttacgaacccacaaggcaactggcta
ctggttggttcaccgtggagtggcttccctgagaaccgaatgggagatgtgtacaagtgc
cctgtggacctacccactgccacctgtgaaaagctgaatctgcaaaattcagcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggattgaccctcaccaggaatccg
gggaccggaggctttctaacctgtggtcctctctgggcacatcagtgtggaaatcagtat
tatgcaactgggatctgttctgatgttagtccagactttcagttcttgaccagcttttca
cctgcagttcaggcttgcccttccctcgtggatgttgtagttgtatgtgatgaatcaaac
agtatttatccttgggaagcagtaaagaactttttggtaaagtttgtgacaggcctggat
ataggacctaaaaagacacaggtggcgttaattcaatatgccaatgagccgagaattata
tttaacttgaacgatttcgaaaccaaagaggatatggtccaggccacatctgagacgcgc
caacatggtggggacctcacaaacaccttcagagctatcgaattcgcaagagactacgct
tattcacagacttctggcgggcgcccgggtgctacaaaagtcatggtagttgtgaccgat
ggcgagtcccatgatgggtcgaagctgaaaactgtgatccagcaatgcaatgatgacgag
atactgaggttcggcatagcagttcttgggtatttaaacagaaatgctcttgatactaaa
aatttaatcaaagaaataaaagcaattgctagtactccaaccgagagatactttttcaat
gtggccgacgaagcggctcttctggagaaggctggaactctaggggagcaaatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagttggattc
agtgcagattacgctcctcaaaatgatattctgatgttaggtgcagtgggggcttttgac
tggagtggaactcttgtccaggagacatctcacaagcccgtgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaaccacagttcgtttttaggttactctgtggctgca
atttctactgaagacggtgtccattttgttgctggtgctcctcgagcaaattatactggc
cagatagtgttgtacagcgttaacaagcaaggcaatgtgaccgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgctcagttgatgtagataaagac
accattacagacgtgctcctggtaggtgctcctacatacatgaacgacctcaagaaagaa
gagggaaaagtctacctatttaccatcacaaagggcatcttgaatcagcaccagtttctt
gaagggccagaaggcactggaaatgctcggtttggttcagcaattgcagccctgtcagac
atcaacatggatggctttaatgatgtgattgtcggttcacctgtagagaatgagaactct
ggagctgtgtacatttacaatggtcaccagggtaccattcgcaccaagtactcccagaaa
atccttgggtccaatggagcctttaggagacatctccagttctttggaaggtccctggat
ggctatggtgatttaaatggggattccatcactgatgtatccattggtgctttggggcaa
gtgattcaactctggtcacaaagcattgctgacgtggccatagaagctttgttcactcca
gacaaaatcactttgctcaacaaggatgctaagataaccctaaagctctgcttcagagca
gagtttagacctgctgggcaaaacaatcaagtagccatcctgtttaacatgacgcttgat
gcggacggacattcatccagggtaacctccaggggggtgttcagagaaaacagtgagcga
ttcttgcagaagaatatggtggtaaacgaagtgcagaagtgttctgagcaccacattagc
atacagaagccctctgatgttgtcaaccctttggatctgcgtgtggacatcagtttggaa
aacccaggcactagccctgccctcgaagcctattctgaaactgtcaaagtcttcagtatc
cctttctataaggagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
caacagctgccagccattcaaactcaatcctttattgtcagtaaccaaaacaagaggtta
acattttcagtcatcctgaaaaacagaggggaaagtgcatacaacactgtggtcctggcc
gagttttctgagaacttgttttttgcttctttctccatgccggtcgatggaacagaagta
acatgtgaggttggttcatcgcagaaatctgttacctgtgatgtgggataccctgcctta
aagagtgaacagcaggtgacttttaccattaacttcgactttaatcttcaaaacctccag
aaccaggcggccatcaatttccaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagtctcacgattcctctcctgtatgatgccgaacttcacttaacccgatcc
accaacatcaacttctatgagatctcttcggatgagaacgctccttctgtcatcaagagt
gtcgaagatattggtcctaaattcatcttctccctcaaggtaacagccggaagtgcccca
gtgagcatggcattggtgactatccacattcctcagtacaccaaggaaaagaacccactc
ctgtatctgactgggatacaaacagaccaggctggcgacatcagctgcacagcagaaata
aatccactcaagctaccacacaccgccccttctgtatctttcaagaatgaaaacttccgg
catacgaaagaattggactgcagaaccacttcctgcagtaacatcacctgctggctgaaa
gaccttcacatgaaagcagagtacttcatcaatgtgacaaccagagtttggaacaggacc
tttgctgcttcgactttccagactgtgcagctgacagcagcggcagagatcgatacacat
aaccctcagctcttcgtgattgaggaaaatgctgtcacgattcccctcatgataatgaaa
cccacggagaaagcagaagtaccgacaggggttatcataggcagcataattgcgggaatc
cttttgctgttggctatgactgcaggtttgtggaagctcggcttcttcaaaagacaatat
aagaaaatgggccaaaatccagatgagatggatgagaccacagaactcaacagctaa

DBGET integrated database retrieval system