KEGG   Mus musculus (mouse): 16399
Entry
16399             CDS       T01002                                 

Gene name
Itga2b, AI172977, CD41, CD41B, Gp, GpIIb, al, alphaIIb
Definition
(RefSeq) integrin alpha 2b
  KO
K06476  integrin alpha 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16399 (Itga2b)
   04151 PI3K-Akt signaling pathway
    16399 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16399 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16399 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16399 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16399 (Itga2b)
   04611 Platelet activation
    16399 (Itga2b)
   04613 Neutrophil extracellular trap formation
    16399 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16399 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16399 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16399 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16399 (Itga2b)
   05410 Hypertrophic cardiomyopathy
    16399 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16399 (Itga2b)
   05414 Dilated cardiomyopathy
    16399 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    16399 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16399 (Itga2b)
   04515 Cell adhesion molecules [BR:mmu04515]
    16399 (Itga2b)
   04090 CD molecules [BR:mmu04090]
    16399 (Itga2b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16399 (Itga2b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16399 (Itga2b)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16399 (Itga2b)
CD molecules [BR:mmu04090]
 Proteins
  16399 (Itga2b)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 16399
NCBI-ProteinID: NP_034705
MGI: 96601
Ensembl: ENSMUSG00000034664
Vega: OTTMUSG00000002857
UniProt: Q9QUM0
Position
11 D; 11 66.29 cM
AA seq 1033 aa
MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGPNGSHFGFSVDFHKDK
HGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLRDETRNLGFQIFQTFKT
GQGLGASVVSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFLAQLQSGGRAEYSPCRAN
TMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLARVPIENIISSYRPG
TLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEIL
DSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYL
FLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQL
DLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICHTTGAFLRDEADFRDKLSPIVLSLN
VSLPPEETGGAPAVVLHGETHVQEQTRIILDCGEDDLCVPQLRLTATAGDSPLLIGADNV
LELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELG
NPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVMLPVAIQAEATVEL
RGNSFPASLVVAAEEGDREQEDLDRWVSRLEHTYELHNIGPGTVNGLRLLIHIPGQSQPS
DLLYILDVQPQGGLLCSTQPSPKVDWKLSTPSPSSIRPVHHQRERRQAFLQGPKPGQQDP
VLVSCDGSASCTVVECELREMVRGQRAMVTVQVMLGLSSLRQRPQEQFVLQSHAWFNVSS
LPYSVPVVSLPSGQARVQTQLLRALEERAIPVWWVLVGVLGGLLLLTLLVLAMWKAGFFK
RNRPPLEEDEEEE
NT seq 3102 nt   +upstreamnt  +downstreamnt
atggccagagcctcctgcgcatggcattccctgtggcttctgcagtggacaccactgttc
ttgggtcctagtgctgttcctccagtctgggccttgaacctggactctgagaagttctcc
gtctatgcaggtcccaatggcagccactttggcttctcagtggactttcataaggacaaa
catggaagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaagtcaagaggag
actggagccgtattcctgtgcccctggaaggccaatggtggcaagtgcaacccgttgctc
ttcgacctcagggatgagacacgaaacctaggcttccaaattttccaaaccttcaagacc
gggcaaggacttggggcgtcggtcgtcagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctggaaaagcgcgatgaggcagagaagactccggtaggaggc
tgcttcttggctcagctccaaagcgggggccgcgcagagtactcgccctgtcgcgccaac
accatgagctccgtttacgcagagagttttcgcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggagcccctggaggctacttt
tttttaggtctcctggctcgcgttccaattgagaacatcatctccagctaccgcccgggt
acccttttgtggcatgtttccaaccagcgcttcacctacgacaacagcaacccagtgttt
ttcgatggttaccggggatattcggtagccgtgggcgagtttgatggggatccgagcact
acagagtacgtatcgggtgcccccacttggagctggaccttgggagcggtggaaattttg
gactcctactaccagcccctgcaccggcttcatggagaacagatggcttcatatttcggg
cactcggtggcagtcactgacgtcaacggggacgggaggcatgacctactggtgggggct
ccattgtatatggagagcagggcagaccgcaagctggccgaggtgggccgcgtttatttg
tttctgcagcctaagggcccccaagctctgagcacacccactctcctgctgactggcacc
cagctctatgggagatttggatctgccattgcacccctgggtgacctcaaccgagacggc
tataatgatattgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattcctgggtcagagtgaagggctgagtccacgcccctcccaggttctggacagcccc
ttccccacaggctctggctttggcttctcccttcgtggtgctgtagacatcgatgacaat
ggatacccagacctgattgtgggagcatatggagctagcaaggtggctgtgtacagagct
cagcctgtggtgatggccactgtccaactgatggttcaagactccctgaatccaacactg
aagaactgtgtcctggatcagaccaagacaccagtcagctgcttcaacatccagatgtgt
gtgggagccacaggacacaacattcctcagaagctgcatctaaaggcagagctgcagctg
gacttacagaagccccgtcagggccgccgggtgctcctgctggcatcccaacaggcgagc
ctcaccctgagcctggacctgggcggaagagacaagcctatctgccacaccacgggggcc
ttccttcgggatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaac
gtgtcgctgcccccagaagagactggaggagcccctgccgtggtattgcatggagaaacc
catgtccaggagcagacacggatcatcctggattgtggggaagacgacctgtgtgtgcca
cagctccggctcacagctactgcgggggactccccactcctaatcggtgctgacaatgtg
ttggagctgaagattgaagcagccaatgatggtgagggagcctatgaagcggagctggct
gtgcatctgcctccaggtgcccactacatgcgggctctcagcaacattgagggctttgag
aggcttgtctgcactcagaagaaagagaatgagtccagggtggccctctgtgagctgggc
aaccccatgaaaaaggacacccggataggaatcacaatgctggtgagtgtggagaacctg
gaagaagctggcgagtccgtgtccttccagctgcaggtcaggagcaagaacagccagaat
ccaaacagtaaggtcgtgatgttgcctgtggcaatccaagctgaagccacagtggagctt
cgagggaattccttccctgcctccctggtggtggcagcagaagaaggtgacagggagcag
gaagacttggacagatgggtctccaggctggagcacacctatgagctccacaacattggc
cctggcactgtgaatggcctcagacttctcatccacattcctggccagtcccagccctcg
gatctgctctacatcctggatgtgcagccgcagggaggtctcctttgctccacacagcca
tctcccaaggtggactggaaactatccacgcccagcccttcttccattcgccccgtccat
caccagcgtgagcgcagacaggcattcctgcaggggcccaagccagggcagcaggaccca
gttctggtgagctgcgacggctcagcgtcctgtacggtggtggagtgtgagctgcgggag
atggtgcgcgggcagcgggccatggttactgtgcaggtcatgctggggctgtccagcctc
cgccagaggccgcaggagcagtttgtgctgcagtcgcacgcctggttcaacgtctcctcc
ctaccttactcggtgccggtggtcagcttgcccagtgggcaagctcgggtgcagacacag
ctgcttcgggccttggaggagagggccattcctgtctggtgggtgctggtgggcgtgctg
ggcggtctgctgctgctgaccctgctagttttggccatgtggaaggctggcttcttcaag
cggaatcgaccgcctctggaggaagatgaagaggaagagtga

DBGET integrated database retrieval system