KEGG   Mus musculus (mouse): 16400
Entry
16400             CDS       T01002                                 

Gene name
Itga3, AA407068, CD49C, GAPB3
Definition
(RefSeq) integrin alpha 3
  KO
K06482  integrin alpha 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16400 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16400 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16400 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16400 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16400 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16400 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16400 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16400 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16400 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16400 (Itga3)
   05414 Dilated cardiomyopathy
    16400 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16400 (Itga3)
   04515 Cell adhesion molecules [BR:mmu04515]
    16400 (Itga3)
   04090 CD molecules [BR:mmu04090]
    16400 (Itga3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16400 (Itga3)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16400 (Itga3)
CD molecules [BR:mmu04090]
 Proteins
  16400 (Itga3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 16400
NCBI-ProteinID: NP_038593
MGI: 96602
Ensembl: ENSMUSG00000001507
Vega: OTTMUSG00000001616
UniProt: Q62470
Position
11 D; 11 59.01 cM
AA seq 1053 aa
MGPGPCRVPRAPGWLLRALALMVAACGRVAFAFNLDTRFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAPRHQHMGAVFLLKQESGGDLQRKQVLK
GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGASFPDQPSL
LLHGPSRSAFGISIASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLRQPQQIIHG
EKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAV
LDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVF
HGFFSMPETHCQTLELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDAYPVLNQ
AQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTN
SPSSQRAGEDAHEALLTLEVPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLI
AFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLMNHRLQSFFGGT
VMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITI
HSNGSWPCQPSGNLVNPLNLTLSDPGVTPLSPQRRRRQLDPGGDQSSPPVTLAAAKKAKS
ETVLTCSNGRARCVWLECPLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFL
RTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGF
FKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3162 nt   +upstreamnt  +downstreamnt
atgggccccggcccctgccgcgtgccccgcgcccctggctggctgctccgcgctctggcc
ttgatggtggcggcttgcggccgggtcgccttcgccttcaacctggacacccgattcctg
gtggtgaaggaggcggtgaaccccggtagcctcttcggctactcggtcgccctccatcgg
cagactgagcgacaacagcgctacctccttctggccggggctccccgggacctcgctgtg
ggtgatgactataccaaccggactggtgctgtgtacctgtgtcccctcacggcccacaag
gacgactgtgaacggatggacatttcagagaaaagtgaccctgaccatcacattattgag
gatatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctagaagaccagcggcgcatggtgggc
aagtgctatgtgcgtggcaatgacctacagctcgaccccggcgatgactggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagaccggcatgtgccagctgggc
accagcggcggcttcacccagaacaccgtatacttcggtgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatctgaatatagctacagg
ggctcagaggagcaaggaaacctttatattgggtacacggtgcaggtaggcaacgccatc
ctacatcccacggacatcatcactgttgtgacgggtgccccacggcaccaacatatgggc
gctgtcttcttgctgaagcaagagtcaggtggagacctgcagaggaagcaggtgctgaag
ggcacgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgat
gggtggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtaggg
ggtgccgtctatgtcttcatgaaccaggcgggcgcatccttccctgatcaaccttccctc
ctgcttcacggccccagccgctctgcctttggcatctctatagccagcatcggtgacatc
aaccaggatggattccaggacatcgctgtgggagccccatttgagggcttgggcaaagtc
tacatctaccacagcagctccggggggctcctcaggcagccccagcagataatccatgga
gagaaactcggactgccaggcttggccaccttcggctactccctgagcgggaagatggat
gtggatgaaaacctttacccagacctgctagtagggagcctgtcggaccacatcgtgctg
ctgcgggcccggcctgtcatcaatatcctccataggaccttggtggccaggccagctgtg
ttggaccctgcgctttgtacagctacctcctgtgttcaggtggagctgtgttttgcctac
aaccagagcgctgggaaccccaactacaggcggaacatcaccctggcttacacactggag
gctgacagggaccgacgcccacccaggctccgatttgcccgcagccagtcatctgtcttc
cacggcttcttctccatgccagagacacattgccagacactggagttactgctgatggac
aatgttcgcgataaactccgtcctatcgtcattgccatgaactactccttacctctgcgc
atgcctgatcgcctcaagctcggcttgcggtctctggatgcctacccagtcctcaaccag
gcacaggctatggagaatcacactgaggtccacttccagaaagagtgcgggccagacaac
aagtgcgacagcaacctgcagatgcgagcagccttcctgtctgagcagctgcagcctcta
agcaggctccagtacagcagagacactaagaaactgtttttgagcatcaatgtgaccaat
tcaccgagcagccaacgggctggggaagatgcgcatgaggcattgctcaccctagaggtg
ccatccgccctgctactgtcctccgtgcgcccgtctgggacctgccaagctaataacgag
accatcctgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatt
gcctttgaggtcatcggggtaacgttgcacacgagggacctcccagtacttcttcagctg
tccacgtcgagtcaccaggacaacttgcagcccgtactcctgactttgcaggtggactac
accctccaggcctcgctcagcttaatgaatcatcggttgcagagcttctttggtggcaca
gtgatgggtgaggctgccatgaaaactgcggaggatgtgggaagtcccctgaaatatgaa
ttccaggtgagcccagtgggagatgggctggcagccttgggcacactggttctaggtctg
gagtggccctatgaagttaccaatggcaagtggctgctgtaccccacggagatcaccatc
catagcaatggttcctggccctgccagccgtctggaaaccttgtcaaccctctcaacctt
actctctctgaccctggagtcacaccactgtcgccacagcgccgccggcggcaactggat
ccagggggagaccagagttccccgcctgtcacactagctgctgccaaaaaagccaagtct
gagactgtgttgacctgctccaatggccgtgcccgctgtgtgtggctggagtgccccctt
ccagacacctccaacattaccaatgtgaccgtgaaagcacgggtgtggaacagcaccttc
attgaggactacaaagactttgacagagtcagggtagatggctgggctaccctgttcctg
agaaccagcatccctaccatcaacatggagaacaagaccacatggttctctgtggacatt
gactcagagctggtggaggagctgccggctgagattgagctgtggttggtgcttgtggcc
gtgggtgctgggttgctgctgctggggctcatcatcctcctcttgtggaagtgcggcttc
ttcaagcgagcccgcactcgtgccctgtatgaagctaagaggcagaaggctgagatgaag
agccagccgtcagagacagaaaggctgaccgacgactactga

DBGET integrated database retrieval system