KEGG   Mus musculus (mouse): 16403
Entry
16403             CDS       T01002                                 

Gene name
Itga6, 5033401O05Rik, AI115430, Cd49f, VLA-6
Definition
(RefSeq) integrin alpha 6
  KO
K06485  integrin alpha 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05145  Toxoplasmosis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16403 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16403 (Itga6)
   04514 Cell adhesion molecules
    16403 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16403 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16403 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16403 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16403 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16403 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16403 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16403 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16403 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16403 (Itga6)
   05414 Dilated cardiomyopathy
    16403 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16403 (Itga6)
   04515 Cell adhesion molecules [BR:mmu04515]
    16403 (Itga6)
   04090 CD molecules [BR:mmu04090]
    16403 (Itga6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16403 (Itga6)
  Exosomal proteins of breast milk
   16403 (Itga6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16403 (Itga6)
CD molecules [BR:mmu04090]
 Proteins
  16403 (Itga6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 16403
NCBI-ProteinID: NP_001264899
MGI: 96605
Ensembl: ENSMUSG00000027111
Vega: OTTMUSG00000013266
UniProt: Q61739 Q6PEE8
Position
2 C2- C3; 2 42.79 cM
AA seq 1091 aa
MAVAGQLCLLYLSAGLLARLGTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPMSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGK
WSNVKPIRLNGTKDSMFGISVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSPTGIITK
PTQVLEGTSPYFGYSIAGNMDLDRNSYPDLAVGSLSDSVTIFRSRPVINILKTITVTPNR
IDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHNEINYLKLKESHNSRK
KRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNST
FLEEYSKLNYLDILLRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYSGVAWWIILL
AVLAGILMLALLVFLLWKCGFFKRSRYDDSIPRYHAVRIRKEEREIKDEKHMDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggtcgcgggccagttgtgcctgctctacctgtccgcggggcttctagcccggctg
ggtacagccttcaacctggacacccgcgaggacaacgtgatccggaaatcgggggatccc
gggagcctcttcggcttctcgctcgccatgcactggcagttgcagccggaggacaagcgg
ctgttgcttgtgggggcacctcgggcagaagcactcccgctgcagagggcgaacagaaca
gggggcctgtacagctgtgacatcacctcccggggaccttgtacacggattgaatttgat
aatgacgctgatcctatgtcagaaagcaaggaagaccagtggatgggagtcactgttcag
agccaaggtccagggggcaaagtggtgacgtgtgcacatcgatatgagaaacggcagcac
gtcaacacgaagcaggagtcgcgggatatctttggaagatgttatgtcctaagtcagaat
ctcagaattgaagatgatatggacggaggagactggagtttctgcgatggccggttgaga
ggccatgaaaagtttggctcctgtcagcaaggagtagcggctactttcactaaggacttt
cattacattgtttttggagccccagggacttacaactggaaagggatcgtccgtgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccctatgaagttggt
ggagagactgatcatgatgaaagtctcgtgcccgttcctgctaacagttacctaggcttt
tcactggactcagggaagggtattgtttctaaagatgacatcacttttgtgtctggtgct
ccaagagccaatcacagtggggctgtagttttgctaaaaagagacatgaagtccgcgcat
ctgctccctgagtatatatttgacggagaaggcctggcttcctcgtttggctatgatgtg
gcagtggtggacctcaatgcagatgggtggcaagacattgttatcggagctccacagtat
tttgatagggatggtgaagtcgggggtgcagtttacgtctacattaaccagcaaggcaaa
tggagtaatgtgaagccgattcgtctaaatgggaccaaagactcgatgtttggaatctct
gtgaaaaatataggtgatattaaccaagatggctatccagatattgctgttggagctccc
tatgatgatctggggaaggtttttatctatcatggatccccgactggcataattaccaag
ccaacacaggttctcgaggggacatcgccttacttcggctattcaatcgctgggaatatg
gacctggatcggaattcctaccccgaccttgctgtgggctccctctcagactcggtcact
attttcagatcccggccagtgattaacattctaaaaaccatcacagtgactcctaacaga
attgacctccgccagaagtccatgtgtggctcacctagcgggatatgcctcaaggttaaa
gcctgttttgaatatactgcgaaaccttccggttataaccctccaatatcaattttgggt
attctcgaagctgaaaaagaaagaagaaagtcagggttgtcatcgagagttcagtttcga
aaccaaggttccgagccaaagtatactcaggagctgaccctgaatcggcagaagcagcgg
gcgtgcatggaggagaccctctggctgcaggagaacatcagagacaagctgcgtcccatc
cccatcacggcttctgtggagatccaggagcccagctctcgccggcgggtgaactcactc
cccgaagttcttcccatcctgaattcaaatgaagccaaaacggtccagacagatgtccac
ttcttaaaggaaggatgtggagacgacaatgtctgtaacagcaaccttaagctagagtat
aaatttggtacccgagaaggaaatcaagacaaattctcttaccttccaattcaaaaaggc
atcccagaattagtcctaaaagatcagaaagatatagctctggaaataacggtgaccaac
agcccttcggatccaaggaatccccggaaagatggcgacgatgcccatgaagccaaactc
atcgccacgtttccagacactctgacatattccgcttacagagaactgagggctttccct
gagaagcagctgagctgtgtggccaaccagaatggctcccaagccgactgtgagctcgga
aatcctttcaagagaaattccagtgttactttctatctgattttaagtacaaccgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggctccaattacagcgaaggcaaaagtggttattgaattgcttttatcggtctcc
ggagtcgctaagccttcgcaggtgtattttggaggtacagttgttggtgagcaagctatg
aaatctgaagatgaagtaggaagtttaatagagtatgaatttagggtgattaacttaggc
aagcctcttaaaaacctcggcacagcaaccttgaatatacagtggcccaaggagattagc
aatggcaaatggttgctttatttgatgaaagttgaatccaaaggtttggagcagattgtt
tgtgagccacacaatgaaataaactacctgaagctgaaggagtctcacaactcaagaaag
aaacgggaacttcctgaaaaacagatagatgacagcaggaaattttctttatttcctgaa
agaaaataccagactctcaactgcagcgtcaacgtgaggtgtgtgaacatcaggtgccca
ctgcgagggctggacagcaaggcctctctcgttcttcgttccaggttgtggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcctgagggcttccatagat
gtcaccgctgctgctcagaatatcaagctccctcacgcgggcactcaggttcgagtgacg
gtgtttccctcaaagactgtagctcagtattcaggagtagcttggtggatcatcctcctg
gctgttcttgccgggattctgatgctggctctattagtgtttttactgtggaagtgtgga
ttctttaagcgctctaggtacgatgacagcattccccgataccatgcggtgcggatccgg
aaagaagagcgagagatcaaagatgagaaacacatggataacctcgaaaaaaaacagtgg
atcaccaagtggaatgaaaacgaaagttactcatag

DBGET integrated database retrieval system