KEGG   Mus musculus (mouse): 16404
Entry
16404             CDS       T01002                                 

Gene name
Itga7, [a], [a]7, al, alpha7
Definition
(RefSeq) integrin alpha 7
  KO
K06583  integrin alpha 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16404 (Itga7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16404 (Itga7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16404 (Itga7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16404 (Itga7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16404 (Itga7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16404 (Itga7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16404 (Itga7)
   05414 Dilated cardiomyopathy
    16404 (Itga7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16404 (Itga7)
   04515 Cell adhesion molecules [BR:mmu04515]
    16404 (Itga7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16404 (Itga7)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16404 (Itga7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF3488 UstYa DUF2207
Other DBs
NCBI-GeneID: 16404
NCBI-ProteinID: NP_001317089
MGI: 102700
Ensembl: ENSMUSG00000025348
UniProt: Q3TZS3
Position
10 D3; 10 77.2 cM
AA seq 1140 aa
MARIPRCDFLRPPGIYYLITSLLAGLFLPPAIAFNLDVMGAIRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYESRQRVDQALETRDVIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAATFSPDSHYLVFGAPGTYNWKGTARVELCAQGSPDLAH
LDDGPYEAGGEKEQDPRLIPVPANSYLGFSIDSGKGLMRSEELSFVAGAPRANHKGAVVI
LRKDSASRLIPEVVLSGERLTSGFGYSLAVTDLNNDGWADLIVGAPYFFERQEELGGAVY
VYMNQGGHWADISPLRICGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARPVLH
VSQEIFIDPRAIDLEQPNCADGRLVCVDIKICFSYVAVPSSYSPSVALDYMLDGDTDRRL
RGQVPRVTFLSRGLDDLRHQSSGTVWLKHQHDRVCGDTVFQLQENVKDKLRAIVVTLSYG
LRTPPLGRQAPGQELPTVAPILNAHQPSTQRTEIHFLKQGCGEDKICQSNLQLERYQFCS
RISDTEFQALPMDLDGRTALFALSGQPFIGLELTVTNLPSDPARPQADGDDAHEAQLLVT
LPASLRYSGVRALDSVEKPLCLSNDSASHVECELGNPMKRGAQVTFYLILSTSGITIETT
ELEVKLLLATISEQELDPVSVRAHVFIELPLSISGVATPQQLFFSGEVKGESAMRSERDV
GSKVKYEVTVSNQGQSLNTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGKRGICS
PRPNILQLDVDSRDRRRRELGQPEPQEPPEKVEPSTSWWPVSSAEKRNVTLDCAQGTAKC
VVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYMAVKSLEVIVRANITVKSSIKNLLLRDAS
TVIPVMVYLDPMAVVVEGVPWWVILLAVLAGLLVLALLVLLLWKLGFFKRAKHPEATVPQ
YHAVKIPREDRQQFKEEKTGTIQRSNWGNSQWEGSDAHPILAADWHPELGPDGHPVPATA
NT seq 3423 nt   +upstreamnt  +downstreamnt
atggccaggattccgaggtgcgattttctccggccccccggaatctactatcttattact
tccttgctcgctggactgttcttaccaccggctatcgccttcaatctggatgtgatgggt
gccatacgcaaggagggagaacccggcagcctattcggcttttcggtggccctgcaccga
caattacagccccgaccccagagctggctgctggtgggcgctccccaggccctggctctt
cctggacagcaggcaaaccgcaccggaggcctctttgcttgtcccctgagcctagaggag
acagattgctacagagtggacattgacaggggagctaacgtgcagaaggagagcaaggag
aaccaatggctgggagtcagtgtccggagccaggggccagggggcaagattgttacgtgt
gcacaccgatatgagtctcgacagagagtggaccaggctttggagactcgggatgtgatt
ggccgctgctttgtgctaagccaggacctggccatccgtgatgagctggatggtggggag
tggaagttctgtgaggggcgcccccagggccatgaacagtttgggttctgtcagcagggc
acagctgccaccttctcccctgacagtcactacctcgtctttggggctccaggaacctat
aactggaagggcacggccagggtggagctctgtgcgcagggctcgccggacctggcacac
ctggatgacgggccctacgaggcggggggcgagaaggagcaagacccccgcctcatcccg
gtccctgccaacagctaccttggtttctccatcgattctgggaagggtcttatgcgctca
gaagagctgagttttgtggcaggggccccacgtgccaaccacaaaggggctgtggtcatt
ctgcgcaaggatagcgccagccgcttgatacctgaggttgtgctgtctggggagcgcctg
acctctggctttggctactcactggctgtgactgatctcaacaatgatggctgggcagac
ctgattgtgggtgccccctacttctttgaacgccaagaagagctgggaggtgctgtgtat
gtgtacatgaaccagggtggccattgggcagatatctctcctctccgaatctgtggctcc
cctgattccatgtttgggatcagtttggctgtattgggggacctcaaccaagatggcttc
ccagacattgccgtgggagctccctttgacggagatgggaaggtctttatctaccatggg
agcagccttggggtggttgtcaaaccttcacaggtgctggagggcgaggcggtgggtatc
aagagctttggttactccctgtctggtggcctggatgtggatggaaatcactacccagac
ctgcttgtgggctccctggctgataccgctgctctgttcagggccagacctgttctacat
gtctcccaagagatcttcattgaccccagagccatcgatctggaacaacccaactgtgcc
gatggacgcttggtctgtgtggacataaagatctgtttcagctatgtcgctgtgcccagc
agctacagccctagtgtggccttagattatatgttagatggggacacagaccggaggctc
cggggccaggttccacgtgtgacgtttctgagccgaggcctggatgacctcaggcatcag
tcctccggcaccgtgtggctgaagcaccaacatgaccgagtctgtggagatactgtgttc
cagctgcaggaaaacgtcaaagacaagctacgggccattgtggtgaccctgtcatatggt
ctccgaacccctccattagggaggcaagcacctggccaggagctccccactgtggctccc
atcctcaatgctcaccagcccagcacccagaggactgagatccactttctgaagcaaggc
tgcggtgaagataagatctgtcagagcaacctccagctcgagcggtaccagttctgttcc
aggatcagcgacacagagttccaggctctgcccatggatctggatggaaggaccgccctg
ttcgcattgagtgggcagccgttcataggcctggaactgacagtcaccaacctgccctct
gaccctgcccggcctcaggcagatggggatgatgctcatgaagcacagctcttggtcact
ctcccagcctctctacggtactcaggagtccgtgctctggactctgtggagaagccgctc
tgcctgtccaatgacagcgcctctcatgtcgagtgtgagctggggaaccctatgaagaga
ggcgctcaggtcactttttacctcatcctcagcacctctgggatcactattgagaccaca
gagctggaggtgaaattgctgttagccacgatcagtgagcaggagctggatccggtctcc
gttcgggctcatgtcttcattgaattgccactgtccatttcaggggtggccactccccag
caactcttcttctctggcgaggtgaagggcgaaagtgccatgcgatctgagagggacgtg
ggcagcaaagtcaagtatgaggtcacggtctccaatcaaggccagtctctcaatactctg
ggctctgcgttcctcaacatcatgtggccccacgagatcgccaatggaaagtggctgctg
taccccatgcgggtagagctggagggcggacaggggcctggcaagagagggatctgttcc
ccaagacccaacatcctccagctggatgtggacagcagggataggaggcggcgagagctg
gggcagccggagccgcaggagcctccagagaaggtggagcctagcacatcctggtggcca
gtgtcctctgctgagaagagaaacgtgactctggactgcgcccagggcacggccaagtgt
gtggtgttcagctgcccactctacagctttgatcgtgcagccgtgcttcacgtctggggc
cgcctctggaacagcacctttctggaggagtacatggccgtgaaatccctggaagtgatc
gtccgagccaacatcacagtgaaatcctccattaagaacttgttgctcagagatgcatcc
acagtgattccagtgatggtgtacttggaccccatggccgtggttgtggaaggagtcccc
tggtgggtcatcctcctggcagtgctggctgggctgttagtcctggccttgctggtactg
ctgctgtggaagctgggattcttcaagcgggcgaagcaccccgaggccaccgtgccccag
taccacgcagtgaagatccctcgggaagaccgacagcagttcaaggaggagaagacaggc
accatccagaggagtaactggggcaactcccagtgggagggctccgacgcacaccccatc
ttggctgccgactggcatcctgagctgggtcctgatggacatccggtgccagccactgcc
taa

DBGET integrated database retrieval system