KEGG   Mus musculus (mouse): 16409
Entry
16409             CDS       T01002                                 

Gene name
Itgam, CD11b/CD18, CR, CR3, CR3A, Cd11b, F730045J24Rik, Ly-4, Ly-40, MAC1, Mac-, Mac-1, Mac-1a
Definition
(RefSeq) integrin alpha M
  KO
K06461  integrin alpha M
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04514  Cell adhesion molecules
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16409 (Itgam)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    16409 (Itgam)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16409 (Itgam)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16409 (Itgam)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16409 (Itgam)
   04610 Complement and coagulation cascades
    16409 (Itgam)
   04613 Neutrophil extracellular trap formation
    16409 (Itgam)
   04670 Leukocyte transendothelial migration
    16409 (Itgam)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16409 (Itgam)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    16409 (Itgam)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16409 (Itgam)
   05134 Legionellosis
    16409 (Itgam)
   05150 Staphylococcus aureus infection
    16409 (Itgam)
   05152 Tuberculosis
    16409 (Itgam)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16409 (Itgam)
   05140 Leishmaniasis
    16409 (Itgam)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16409 (Itgam)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16409 (Itgam)
   04515 Cell adhesion molecules [BR:mmu04515]
    16409 (Itgam)
   04090 CD molecules [BR:mmu04090]
    16409 (Itgam)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16409 (Itgam)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16409 (Itgam)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16409 (Itgam)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16409 (Itgam)
CD molecules [BR:mmu04090]
 Proteins
  16409 (Itgam)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   16409 (Itgam)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha VCBS FG-GAP_2 DUF11 AbfS_sensor
Other DBs
NCBI-GeneID: 16409
NCBI-ProteinID: NP_001076429
MGI: 96607
Ensembl: ENSMUSG00000030786
Vega: OTTMUSG00000058643
UniProt: G5E8F1
Position
7; 7 F3
AA seq 1154 aa
MTLKALLVTALALCHGFNLDTEHPMTFQENAKGFGQSVVQLGGTSVVVAAPQEAKAVNQT
GALYQCDYSTSRCHPIPLQVPPEAVNMSLGLSLAVSTVPQQLLACGPTVHQNCKENTYVN
GLCYLFGSNLLRPPQQFPEALRECPQQESDIVFLIDGSGSINNIDFQKMKEFVSTVMEQF
KKSKTLFSLMQYSDEFRIHFTFNDFKRNPSPRSHVSPIKQLNGRTKTASGIRKVVRELFH
KTNGARENAAKILVVITDGEKFGDPLDYKDVIPEADRAGVIRYVIGVGNAFNKPQSRREL
DTIASKPAGEHVFQVDNFEALNTIQNQLQEKIFAIEGTQTGSTSSFEHEMSQEGFSASIT
SNGPLLGSVGSFDWAGGAFLYTSKDKVTFINTTRVDSDMNDAYLGYASAVILRNRVQSLV
LGAPRYQHIGLVVMFRENFGTWEPHTSIKGSQIGSYFGASLCSVDMDADGNTNLILIGAP
HYYEKTRGGQVSVCPLPRGQRARWQCEALLHGDQGHPWGRFGAALTVLGDVNGDKLTDVA
IGAPGEQENQGAVYIFYGASIASLSASHSQRIIGAHFSPGLQYFGQSLSGGKDLTMDGLM
DLAVGAQGHLLLLRAQPVLRLEATMEFSPKKVARSVFACQEQVLKNKDAGEVRVCLRVRK
NTKDRLREGDIQSTVTYDLALDPGRSRIRAFFDETKNNTRRRTQVFGLMQKCETLKLILP
DCVDDSVSPIILRLNYTLVGEPLRSFGNLRPVLAMDAQRFFTAMFPFEKNCGNDSICQDD
LSITMSAMGLDTLVVGGPQDFNMSVTLRNDGEDSYGTQVTVYYPSGLSYRKDSASQNPLT
KKPWFVKPAESSSSSEGHGALKSTTWNINHPIFPANSEVTFNVTFDVDSHASFGNKLLLK
AIVASENNMSRTHKTKFQLELPVKYAIYMIVTSDESSIRYLNFTASEMTSKVIQHQYQFN
NLGQRSLPVSVVFWIPVQINNVTVWDHPQVIFSQNLSSACHTEQKSPPHSNFRDQLERTP
VLNCSVAVCKRIQCDLPSFNTQEIFNVTLKGNLSFDWYIKTSHGHLLLVSSTEILFNDSA
FALLPGQESYVRSKTETKVEPYEVHNPVPLIVGSSIGGLVLLALITAGLYKLGFFKRQYK
DMMNEAAPQDAPPQ
NT seq 3465 nt   +upstreamnt  +downstreamnt
atgactcttaaagctcttctggtcacagccctagccttgtgtcatggcttcaatctggac
actgaacatcccatgaccttccaagagaatgcaaaaggctttggacagagtgtggtccag
cttggcggaaccagtgtggttgttgcagccccccaggaggcaaaggctgttaaccagaca
ggtgccctctaccagtgtgactacagcacaagccggtgtcaccccatccccctgcaagta
cctccagaggctgtgaatatgtccttgggcctgtccctggctgtttctactgtcccccag
cagctgctggcctgtggccccacggtgcaccaaaactgcaaggagaatacttatgtgaat
ggattgtgctatttgttcggctccaacctgctgaggccgccccagcagttcccagaggct
ctcagagaatgtcctcagcaggagagtgacattgtcttcttgattgatggctccggtagc
atcaacaacattgactttcagaagatgaaggagtttgtctcaactgtgatggagcagttc
aaaaagtctaaaaccttgttctctttgatgcagtactcggacgagttccggattcacttc
accttcaatgacttcaagagaaaccctagcccaagatcacatgtgagccccataaagcag
ctgaatgggaggacaaaaactgcctcagggatccggaaagtagtgagagaactgtttcac
aaaaccaatggggcccgggagaatgctgcgaagatcctagttgtcatcacagatggagaa
aaattcggtgatcccttggattataaggatgtcatccccgaggcagacagagcaggggtc
attcgctacgtaattggggtgggaaatgccttcaacaaaccacagtcccgcagagagctc
gacaccatcgcatctaagccagctggtgaacacgtgttccaagtggacaactttgaagcc
ctgaataccattcagaaccagcttcaggaaaagatctttgcaattgagggcacgcagaca
ggaagtaccagctcctttgagcatgagatgtctcaagaaggcttcagtgcttccattacc
tctaatggtcccttgctgggctctgtggggagctttgactgggcaggtggagccttcctg
tatacatcgaaggataaagtcaccttcatcaacacaaccagagtggattcagacatgaat
gatgcttacctgggttatgcttctgcagtcatcttgaggaaccgtgtccaaagcttggtt
ttaggagcacctcggtatcagcatattggcttggtggtgatgttcagggagaatttcggt
acctgggagccccacactagcatcaagggcagccagattggctcttattttggggcctcc
ctttgctctgtggacatggacgctgatggcaataccaacttgatcctcattggggcccct
cattactatgagaagacccgaggaggccaggtgtcagtgtgtcccttgcctcgagggcag
agggcacggtggcagtgtgaagctcttctccacggtgatcagggtcatccctggggtcgc
tttggggcagccctgacagtgctgggagacgtgaatggggacaaactgacagatgtggcc
attggggccccaggagagcaggagaatcagggcgctgtctacattttttatggagcatca
atagccagcctcagtgcctcccacagccagcggatcataggcgcccacttctcccctggg
ctccagtacttcgggcagtctctgagtgggggtaaggatctcacaatggatggcttgatg
gacctggctgttggggcgcaggggcatcttctgctgctcagagcccagccggtgctgaga
ctggaggcaaccatggaattcagccccaagaaagtagcaaggagtgtgtttgcatgtcaa
gaacaagtattaaaaaacaaggatgctggggaggtcagagtctgcctccgtgtccgcaag
aacaccaaggaccgtctgcgcgaaggagatatccagagcactgtcacttatgacctggct
ttagaccctggccgctcacgtatccgtgccttctttgatgagacaaagaacaacacacgc
aggcgcacccaggtctttggattgatgcagaaatgtgaaacactgaagctaattttaccg
gactgcgtggacgactcagtgagccccatcatcctgcgcctcaattatacactggttggg
gagcccttgaggtcctttgggaacctccgaccagttctggctatggatgctcagaggttc
ttcacagctatgtttccctttgagaaaaattgcggcaatgacagcatctgccaagacgat
ctcagcatcaccatgagtgccatgggcttggacactttggtggtgggaggcccccaggac
tttaacatgagtgtgactctgagaaatgacggtgaggattcctacgggacccaggttacc
gtctactacccatctggcttatcttaccggaaggattcagcaagccagaacccgctcacc
aagaagccttggtttgtaaagcctgctgagtccagctcttcttctgaagggcatggggct
ctgaagagtaccacctggaacataaaccatcccatctttcctgctaattctgaggtcaca
tttaatgtcacatttgatgtggactctcatgcctcctttgggaacaaactgctcctcaaa
gccattgtggccagtgagaacaacatgtccaggacccacaaaaccaagtttcagttggag
ctgcctgtgaagtacgccatctacatgattgtcaccagtgatgagagttctatcagatat
ctcaacttcacggcttcagagatgaccagtaaggtcatacagcatcagtaccagttcaac
aacctgggccagaggagcctccctgtcagtgtagtcttctggatccctgttcagatcaac
aatgtgaccgtatgggatcatccccaggtcatcttctcccagaacctctcaagtgcctgt
cacactgagcagaaatccccccctcactccaatttccgggatcagcttgaaaggacccca
gtgctgaactgctctgttgcagtctgtaagagaattcagtgtgaccttccatccttcaac
actcaggaaatattcaatgtcaccctcaagggcaacctatcatttgactggtacatcaag
acttctcatggtcacctcctgcttgtgagcagcactgagatcctgtttaatgactctgcg
tttgccctgcttccagggcaggagtcgtatgtgaggtctaagacagagaccaaagtggag
ccatatgaagttcacaatcctgtaccactcattgtgggcagctccattgggggcctggtg
ctcttggctctcatcactgctggcctatacaagcttggctttttcaagcggcagtacaag
gacatgatgaatgaagctgccccccaagacgccccacctcagtaa

DBGET integrated database retrieval system