KEGG   Mus musculus (mouse): 16410
Entry
16410             CDS       T01002                                 

Gene name
Itgav, 1110004F14Rik, 2610028E01Rik, CD51, D430040G12Rik
Definition
(RefSeq) integrin alpha V
  KO
K06487  integrin alpha V
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16410 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16410 (Itgav)
   04514 Cell adhesion molecules
    16410 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16410 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16410 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16410 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    16410 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16410 (Itgav)
   05205 Proteoglycans in cancer
    16410 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16410 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16410 (Itgav)
   05165 Human papillomavirus infection
    16410 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16410 (Itgav)
   05410 Hypertrophic cardiomyopathy
    16410 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16410 (Itgav)
   05414 Dilated cardiomyopathy
    16410 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16410 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16410 (Itgav)
   04515 Cell adhesion molecules [BR:mmu04515]
    16410 (Itgav)
   04090 CD molecules [BR:mmu04090]
    16410 (Itgav)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16410 (Itgav)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16410 (Itgav)
  Exosomal proteins of epithelial cells
   16410 (Itgav)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16410 (Itgav)
CD molecules [BR:mmu04090]
 Proteins
  16410 (Itgav)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP FG-GAP_3 Integrin_alpha LYRIC DctQ Collectrin
Other DBs
NCBI-GeneID: 16410
NCBI-ProteinID: NP_032428
MGI: 96608
Ensembl: ENSMUSG00000027087
Vega: OTTMUSG00000013360
UniProt: P43406
Position
2 D; 2 49.33 cM
AA seq 1044 aa
MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPST
SSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLHFQVELLLDKLKQKGAIRR
ALFLHNRSPVHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVNSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAAGQGERNHLITKRDLTLREGDVHTLGC
GIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYK
NLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRV
RPPQEEQEREQLQPHENGEGNSET
NT seq 3135 nt   +upstreamnt  +downstreamnt
atggctgctcccgggcgcctgctgctacgccctcgccccggcggcctcctgctgctgctg
ccgggtctcctgctgcccctcgccgacgccttcaacctggacgtcgaaagtcccgccgag
tatgcgggtcccgagggaagttacttcggattcgccgtggacttcttcgagcccagcacg
tcctccaggatgtttctcctggtgggagcccccaaagcgaacacgacccagcctgggatt
gtagaaggagggcaagttctcaaatgtgaatgctcatccagccgccggtgccagcccatt
gagtttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaagtcc
caccagtggtttggagcctctgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggacggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggccagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
ctcggtggtcctggtagcttttattggcaaggtcagctcatttcggaccaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaattagcaaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtctcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctctttacacaattttactggtgaa
cagatggctgcgtattttggattttctgtagctgctactgacattaatggggatgattac
gcagatgtgtttattggagcccccctgttcatggaccgaggttccgatgggaaactccag
gaggttggccaggtctcagtgtctctgcagagagcagtgggagacttccagactacaaag
ctgaacggctttgaggtttttgccaggtttggaagtgccatagctccattgggagacctg
gaccaggatggcttcaatgatattgcaattgctgctccctatggtggtgaagataagaag
ggacttgtttatatcttcaatggaaggtccacaggcttgaattcggtgccatctcaaatc
ctcgaggggcagtgggctgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagacaggaatggatatccagacttagttgtaggagcttttggtgtggat
cgagctgtcttatacagagccagacccgttgtcactgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataagatctgcccgttgcctgggacagctctcaaggtt
tcctgttttaatgtcagattctgcttaaaggcagatggcaagggaacccttcctcggaag
ctccacttccaggtggagcttctactggataaactcaagcagaagggagccatccgacga
gcactgtttctccataacaggtccccggtccactccaagaccatgactgttttcaggggg
ggacagatgcagtgtgaggaactggtcgcctatcttcgggatgaatctgaatttagagac
aagctcactcccatcaccattttcatggagtatcggttggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
catattctacttgactgtggtgaagacaatgtctgtaaacctaaattggaagtttctgta
aatagtgatcaaaagaagatctatattggggacgacaaccctctgacactgactgtgaag
gcgcagaatcaaggggaaggcgcctatgaagctgagctcatcgtttctatcccaccgcag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaactcggcaggtggtgtgcgaccttggaaacccgatgaaggctgga
actcaactgctcgctggtcttcgtttcagcgtgcaccagcagtcagagatggatacttct
gtgaagtttgacttgaaaatccagagctctaattcttttgacaatgtaagtccagttgtg
tcttacaaggttgacctcgccgttttggctgctgtggagataagaggagtttcaagtcca
gatcatatctttcttccaattccaaattgggagtacaaggaaaaccctgagactgaagaa
gacgttgggcctattgttcagcacatatatgagctgagaaacaatggtccaagttcattc
agcaaggcaattctaaatctccagtggccttacaaatacaacaacaacactctgttgtac
attcttcattacgacattgacgggccaatgaactgcacggcagatacagagatcaaccct
ttgagaatcaagacacccgaaaagaatgacacagcggcggcgggacagggagaaaggaat
catctcatcaccaagcgggatctcaccctcagagagggagatgttcacactttgggctgt
ggaatcgccaagtgcttgcagatcacctgccaggttggtcgactggatagaggcaagagc
gcaatcctgtacgtgaaatccctgctgtggaccgagacgttcatgaacaaggagaaccag
aaccattcctattcgctgaagtcatctgcttcctttaatatcatagaattcccttacaag
aacctgccgatcgaggatctcttcaactctacactagtcaccactaacatcacctggggc
attcagccggcgcccatgcctgtgcctgtgtgggtgatcatcttggcagttctcgcaggg
ctgctgctactggctgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtc
cgaccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaatggcgaagga
aactctgaaacctaa

KEGG   Mus musculus (mouse): 16419
Entry
16419             CDS       T01002                                 

Gene name
Itgb5, AA475909, AI874634, ESTM2, ESTM23, [b]-5, [b]5, [b]5A, [b]5B, beta-, beta-5, beta5
Definition
(RefSeq) integrin beta 5
  KO
K06588  integrin beta 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16419 (Itgb5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16419 (Itgb5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16419 (Itgb5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16419 (Itgb5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16419 (Itgb5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    16419 (Itgb5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16419 (Itgb5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16419 (Itgb5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16419 (Itgb5)
   05414 Dilated cardiomyopathy
    16419 (Itgb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16419 (Itgb5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    16419 (Itgb5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16419 (Itgb5)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16419 (Itgb5)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 16419
NCBI-ProteinID: NP_001139356
MGI: 96614
Ensembl: ENSMUSG00000022817
Vega: OTTMUSG00000028487
UniProt: O70309 Q6PE70
Position
16; 16 B3
AA seq 799 aa
MPRVPATLYACLLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGNPRSI
TSRCDLKANLIRNGCEGEIESPASSTHVLRNLPLSSKGSSATGSDVIQMTPQEIAVSLRP
GEQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLENIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGISYPGQRKCEGLKIGD
TASFEVSVEARSCPGRQAAQSFTLRPVGFRDSLQVEVAYNCTCGCSTGLEPNSARCSGNG
TYTCGLCECDPGYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GRIYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDVSTCRAKDGQ
ICSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSSKRDCVECLLLHQGKPDNQTCHHQ
CKDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFSYTELPNGRSNLTVLREPECGSAPNA
MTILLAVVGSILLIGMALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFAFNKFNKSYNGSVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggtgcccgcgaccctctacgcctgtctgctcgggctctgcgcgctcgttccg
cgcctcgcagggctcaacatatgcactagtggaagtgccacctcgtgtgaagaatgcctg
ttgatccacccaaaatgtgcctggtgctccaaagagtactttggcaatccacggtccatc
acctctcggtgtgacctgaaggcaaacctcatccggaatggctgtgaaggtgagattgag
agtccagccagcagcacccacgtcctccggaacctacctctcagcagcaagggttccagt
gccacgggctctgacgtcatccagatgacgccgcaggagattgcagtgagcctccggcca
ggcgagcagactacgttccagctgcaggtgcgccaggtggaggactaccctgtagacctg
tactacctgatggacctctccctctccatgaaggatgacttggagaacatccggagcctg
ggcaccaagcttgcggaggaaatgaggaagctcactagtaacttccgcttaggtttcggg
tcttttgttgacaaggacatctctcctttctcctacacggcaccgagataccagaccaat
ccgtgtattggttacaagttattccccaactgcgtcccctccttcgggttccggcatctg
ctgcctctcacagacagagtcgacagcttcaacgaggaagtgaggaagcagagggtgtcc
cggaaccgagatgcccccgagggggggtttgatgcggtcctccaggctgctgtctgcaag
gagaagatcggatggcgaaaagatgctctgcacttgctggtgttcacaacagacgatgtg
ccccacatcgcactggatggaaaactgggtggcctggtccagccccacgatggccagtgt
cacctgaatgaagccaatgagtacacagcctctaaccagatggactatccatcgcttgcc
ttgcttggggagaagctggcagagaacaatatcaacctcatttttgctgtgacgaagaac
cactatatgctctacaagaattttacagccctgatacctggaaccactgtggagattttg
catggagattccaaaaatattattcaactgattatcaatgcgtacagtagcatccgggct
aaagtggagctgtcagtgtgggatcagccagaagaccttaatctcttcttcactgccacc
tgccaagatggcatatcttaccctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcctttgaagtgtccgtggaggctcggagctgccccggcagacaagcagcacag
tctttcaccttgaggcccgtgggcttccgggacagtctgcaggtggaagtcgcctacaat
tgcacatgcggctgtagcacggggctggagcccaacagtgccagatgcagtgggaatgga
acatacacctgtgggctgtgcgagtgtgaccccggctacctgggcactaggtgcgagtgc
caggagggggagaaccagagcgggtaccagaacctgtgccgggaggcagagggcaagcct
ctgtgcagcgggcgtggagagtgtagctgcaaccagtgctcctgcttcgagagtgagttc
gggaggatctacggacctttctgcgagtgtgacagcttttcctgtgccagaaacaagggc
gtcctatgctcaggccatggagagtgtcactgtggagaatgcaaatgccacgcaggttac
attggggacaattgtaactgctcaacagacgtcagcacatgcagggccaaggatgggcag
atctgcagtgaccgaggccgttgtgtctgtgggcagtgccagtgcacagagcctggagcc
tttggggagacgtgtgagaagtgcccaacctgcccggatgcttgcagctctaagagagac
tgtgtcgaatgcttgctacttcaccaggggaaacctgacaaccagacctgccaccaccag
tgcaaagatgaggtgatcacgtgggtagacaccatcgtcaaagatgaccaggaggctgtg
ctttgcttctacaaaactgctaaggactgcgttatgatgttcagctacacagaactgccc
aatgggaggtccaacttgacggtcctccgggagccagaatgtggaagtgcccccaatgcc
atgaccatcctgctggctgtggttggcagcatcctcctgattgggatggcactcctggcc
atctggaagctgctcgtcaccatccacgaccgccgagagtttgccaagttccaaagtgag
cgctccagggcccgttatgaaatggcctcaaaccccctgtacagaaagcccatctccaca
cacactgtcgatttcgccttcaacaagttcaacaaatcctacaatggctcagtggactga

DBGET integrated database retrieval system