KEGG   Mus musculus (mouse): 16412
Entry
16412             CDS       T01002                                 

Gene name
Itgb1, 4633401G24Rik, AA409975, AA960159, CD29, Fn, Fnrb, Gm9863, gpIIa
Definition
(RefSeq) integrin beta 1 (fibronectin receptor beta)
  KO
K05719  integrin beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16412 (Itgb1)
   04151 PI3K-Akt signaling pathway
    16412 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16412 (Itgb1)
   04514 Cell adhesion molecules
    16412 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16412 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16412 (Itgb1)
   04530 Tight junction
    16412 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16412 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    16412 (Itgb1)
   04670 Leukocyte transendothelial migration
    16412 (Itgb1)
  09158 Development and regeneration
   04360 Axon guidance
    16412 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16412 (Itgb1)
   05205 Proteoglycans in cancer
    16412 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16412 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16412 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16412 (Itgb1)
   05133 Pertussis
    16412 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    16412 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16412 (Itgb1)
   05140 Leishmaniasis
    16412 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16412 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16412 (Itgb1)
   05414 Dilated cardiomyopathy
    16412 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16412 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16412 (Itgb1)
   04515 Cell adhesion molecules [BR:mmu04515]
    16412 (Itgb1)
   04090 CD molecules [BR:mmu04090]
    16412 (Itgb1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16412 (Itgb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   16412 (Itgb1)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16412 (Itgb1)
CD molecules [BR:mmu04090]
 Proteins
  16412 (Itgb1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 16412
NCBI-ProteinID: NP_034708
MGI: 96610
Ensembl: ENSMUSG00000025809
Vega: OTTMUSG00000034034
UniProt: P09055
Position
8; 8 E2
AA seq 798 aa
MNLQLVSWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCL
ASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttgcaactggtttcctggattggattgatcagtttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgcggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttgcaagaaggaatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccagccaagtgacata
gagaatcccagaggctctcaaactataaagaaaaataaaaatgtcaccaatcgcagcaaa
gggatggcagagaagctccggccagaagacattactcagatccaaccacaacagctgctt
ctaaaattgagatcaggagaaccacagaagtttacattaaaattcaagagggctgaagat
taccctattgatctctactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaaaagtcttggaacggatttgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggagaaaactgtgatgccgtatattagcacaacccca
gcaaagctaagaaatccttgtacaagtgaacaaaactgcaccagcccatttagctacaaa
aatgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcaacgc
atatctggaaacttggattctccagaaggtggctttgatgcaatcatgcaggttgcggtt
tgtggatcgctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggacaa
tgtcacctggaaaataatgtatatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagttactgaagag
ttccaacctgtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacactg
tctggaaactctagtaatgtgatccagctaatcatcgatgcctacaactctctttcttca
gaagtcattctggaaaatagcaaattgccagacggagtaacaataaattacaaatcctat
tgcaagaatggggtgaatgggacaggagaaaatggacgaaagtgttccaacatttctatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaataaggagtct
gaaaccattaaaattaaacctctgggcttcactgaagaagtagaggtcgttcttcagttc
atctgtaagtgcaattgtcaaagccatggcatcccagccagtcccaagtgccatgaggga
aatgggacatttgagtgtggagcctgcaggtgcaatgaggggcgtgttgggaggcactgt
gaatgtagcacagatgaagtgaacagtgaagacatggacgcttactgcaggaaagagaac
agttcggaaatctgcagtaacaatggagaatgtgtctgtggacagtgtgtgtgtaggaag
agagataatacaaatgaaatttactctggaaaattctgcgagtgtgataacttcaactgt
gataggtctaatggcttaatttgtggaggcaatggcgtgtgcaggtgtcgtgtttgtgaa
tgctatcccaattacactggcagtgcatgtgactgttctttggacactggtccatgtcta
gcgtcaaatggtcagatctgcaatggccggggtatttgtgaatgtggtgcttgtaagtgc
acagatcccaagtttcaagggccaacttgtgagacatgtcagacctgccttggcgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacacg
tgtgcacaggagtgctcccacttcaatctcaccaaagtagaaagcagggagaagttgccc
cagccggtgcaggtcgatcctgtgacccattgcaaggagaaggacattgatgactgctgg
ttctatttcacctattcagtgaatggcaacaatgaagctatcgtgcatgttgtggagact
ccagactgtcctactggtcccgacatcatcccaattgtagcaggcgtggttgctggaatt
gttcttattggccttgccttgctgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

KEGG   Mus musculus (mouse): 16416
Entry
16416             CDS       T01002                                 

Gene name
Itgb3, CD61, GP3A, INGRB3
Definition
(RefSeq) integrin beta 3
  KO
K06493  integrin beta 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16416 (Itgb3)
   04151 PI3K-Akt signaling pathway
    16416 (Itgb3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16416 (Itgb3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16416 (Itgb3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16416 (Itgb3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16416 (Itgb3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16416 (Itgb3)
   04611 Platelet activation
    16416 (Itgb3)
   04613 Neutrophil extracellular trap formation
    16416 (Itgb3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    16416 (Itgb3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16416 (Itgb3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    16416 (Itgb3)
   05205 Proteoglycans in cancer
    16416 (Itgb3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    16416 (Itgb3)
   05163 Human cytomegalovirus infection
    16416 (Itgb3)
   05165 Human papillomavirus infection
    16416 (Itgb3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16416 (Itgb3)
   05410 Hypertrophic cardiomyopathy
    16416 (Itgb3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16416 (Itgb3)
   05414 Dilated cardiomyopathy
    16416 (Itgb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16416 (Itgb3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16416 (Itgb3)
   04515 Cell adhesion molecules [BR:mmu04515]
    16416 (Itgb3)
   04090 CD molecules [BR:mmu04090]
    16416 (Itgb3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16416 (Itgb3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16416 (Itgb3)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16416 (Itgb3)
CD molecules [BR:mmu04090]
 Proteins
  16416 (Itgb3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 16416
NCBI-ProteinID: NP_058060
MGI: 96612
Ensembl: ENSMUSG00000020689
Vega: OTTMUSG00000003177
UniProt: O54890
Position
11 E1; 11 67.84 cM
AA seq 787 aa
MRAQWPGQLWAALLALGALAGVVVGESNICTTRGVNSCQQCLAVSPVCAWCSDETLSQGS
PRCNLKENLLKDNCAPESIEFPVSEAQILEARPLSSKGSGSSAQITQVSPQRIALRLRPD
DSKIFSLQVRQVEDYPVDIYYLMDLSFSMKDDLSSIQTLGTKLASQMRKLTSNLRIGFGA
FVDKPVSPYMYISPPQAIKNPCYNMKNACLPMFGYKHVLTLTDQVSRFNEEVKKQSVSRN
RDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVLPNDGHCHI
GTDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVSLYQNYSELIPGTTVGVLSD
DSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTV
SFSIEAKVRGCPQEKEQSFTIKPVGFKDSLTVQVTFDCDCACQAFAQPSSPRCNNGNGTF
ECGVCRCDQGWLGSMCECSEEDYRPSQQEECSPKEGQPICSQRGECLCGQCVCHSSDFGK
ITGKYCECDDFSCVRYKGEMCSGHGQCNCGDCVCDSDWTGYYCNCTTRTDTCMSTNGLLC
SGRGNCECGSCVCVQPGSYGDTCEKCPTCPDACSFKKECVECKKFNRGTLHEENTCSRYC
RDDIEQVKELTDTGKNAVNCTYKNEDDCVVRFQYYEDTSGRAVLYVVEEPECPKGPDILV
VLLSVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFT
NITYRGT
NT seq 2364 nt   +upstreamnt  +downstreamnt
atgcgagcgcagtggccgggacaactctgggccgctctgctggcgctgggggcgctggcg
ggcgttgttgttggagagtccaacatctgtaccacacgaggcgtgaactcctgccagcag
tgtctggctgtgagtcctgtgtgtgcctggtgctcagatgagactttgtctcagggctca
ccccgatgtaacctgaaggagaacctgctgaaggacaattgtgctccagagtctattgag
ttcccagtcagtgaggcccagatcctggaggctaggccactcagcagcaagggctctgga
agcagcgcccagatcactcaagtcagccctcagaggattgcccttcgactacggccagat
gattcgaagatcttctcacttcaagtgcggcaggtggaggattaccccgtggacatctac
tacttgatggacctgtctttctccatgaaggatgatctgtccagcatccagaccctgggt
accaagttggcctctcagatgcgcaagcttactagcaaccttcggattggctttggggcc
ttcgtggacaagcctgtatcgccgtacatgtacatctccccaccacaggcaatcaaaaac
ccctgttacaatatgaagaatgcctgcttgcccatgtttggctacaaacacgtgctgacg
ctaaccgaccaggtgtcccgcttcaatgaagaagtgaagaaacagagcgtgtcccgtaat
cgagatgccccagagggcggctttgacgccatcatgcaggctacagtatgtgatgaaaaa
attggctggaggaatgacgcatcccatttgctagtgtttaccacggatgccaagacccat
attgccctggatggaaggctggcaggcattgtcctgcccaatgatgggcactgtcacatt
ggcaccgacaaccactactctgcctccactaccatggactacccatctctggggctgatg
actgagaaactatcccagaaaaacattaacttgatctttgcagtgactgaaaatgtcgtc
agcctttaccagaattatagtgagctcattcctgggaccacagtgggagtcctgtctgat
gactcaagcaacgtcctccagctcattgttgatgcttacgggaaaatccgctctaaagtg
gagctggaagtacgtgacctgccggaagaactgtcactgtccttcaatgccacctgcctc
aacaacgaggttatcccgggcctcaagtcttgtgtgggcctcaagattggagacacggtg
agctttagtatcgaggccaaggtgcgtggctgcccccaggagaaggagcagtctttcact
atcaagcctgtgggctttaaggacagcctcaccgtccaggtgaccttcgactgtgactgt
gcctgccaggcctttgcccagccttccagcccacgctgcaacaatgggaacgggactttt
gagtgtggggtgtgccgctgtgaccagggctggctggggtccatgtgtgagtgctctgag
gaggattaccgaccctctcagcaggaagagtgcagccccaaggagggccagcccatctgc
agccagcggggagagtgcctctgtggccagtgtgtctgccatagcagcgacttcggcaag
atcactggcaagtactgtgagtgcgatgacttctcctgcgtccgctacaaaggggagatg
tgttccggccatgggcaatgtaactgtggggactgcgtgtgtgactcggactggactggc
tactactgcaactgtactacacgcactgacacctgcatgtccaccaatgggctgctgtgc
agcggccggggcaactgcgagtgcggcagctgtgtgtgcgtccagccaggctcctatgga
gacacctgtgagaagtgccccacctgcccagatgcctgctcctttaagaaggagtgtgtg
gagtgtaagaagttcaaccggggaacgctccatgaagaaaacacctgcagccgctactgc
cgggatgacatcgagcaggtgaaagagctgacggatactggcaaaaacgccgtgaattgt
acctacaagaacgaggatgactgtgtcgtcagattccagtactacgaagacaccagtggg
agggcagtcctctatgtggtggaagagcctgagtgtcccaagggtcctgatatcctggtg
gtcctgctgtcagtgatgggggccatcctgctcattggccttgctactctgctcatctgg
aagctactcatcactatccatgaccggaaggaatttgctaaatttgaggaagaacgagcc
agagccaagtgggacacagcaaacaacccgctgtataaagaggccacctccaccttcacc
aatatcacctaccgggggacttaa

KEGG   Mus musculus (mouse): 16419
Entry
16419             CDS       T01002                                 

Gene name
Itgb5, AA475909, AI874634, ESTM2, ESTM23, [b]-5, [b]5, [b]5A, [b]5B, beta-, beta-5, beta5
Definition
(RefSeq) integrin beta 5
  KO
K06588  integrin beta 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05205  Proteoglycans in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16419 (Itgb5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16419 (Itgb5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16419 (Itgb5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16419 (Itgb5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16419 (Itgb5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    16419 (Itgb5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16419 (Itgb5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16419 (Itgb5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16419 (Itgb5)
   05414 Dilated cardiomyopathy
    16419 (Itgb5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16419 (Itgb5)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    16419 (Itgb5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16419 (Itgb5)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16419 (Itgb5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 16419
NCBI-ProteinID: NP_001139356
MGI: 96614
Ensembl: ENSMUSG00000022817
Vega: OTTMUSG00000028487
UniProt: O70309 Q6PE70
Position
16; 16 B3
AA seq 799 aa
MPRVPATLYACLLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGNPRSI
TSRCDLKANLIRNGCEGEIESPASSTHVLRNLPLSSKGSSATGSDVIQMTPQEIAVSLRP
GEQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLENIRSLGTKLAEEMRKLTSNFRLGFG
SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
HGDSKNIIQLIINAYSSIRAKVELSVWDQPEDLNLFFTATCQDGISYPGQRKCEGLKIGD
TASFEVSVEARSCPGRQAAQSFTLRPVGFRDSLQVEVAYNCTCGCSTGLEPNSARCSGNG
TYTCGLCECDPGYLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEF
GRIYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDVSTCRAKDGQ
ICSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSSKRDCVECLLLHQGKPDNQTCHHQ
CKDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFSYTELPNGRSNLTVLREPECGSAPNA
MTILLAVVGSILLIGMALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
HTVDFAFNKFNKSYNGSVD
NT seq 2400 nt   +upstreamnt  +downstreamnt
atgccgcgggtgcccgcgaccctctacgcctgtctgctcgggctctgcgcgctcgttccg
cgcctcgcagggctcaacatatgcactagtggaagtgccacctcgtgtgaagaatgcctg
ttgatccacccaaaatgtgcctggtgctccaaagagtactttggcaatccacggtccatc
acctctcggtgtgacctgaaggcaaacctcatccggaatggctgtgaaggtgagattgag
agtccagccagcagcacccacgtcctccggaacctacctctcagcagcaagggttccagt
gccacgggctctgacgtcatccagatgacgccgcaggagattgcagtgagcctccggcca
ggcgagcagactacgttccagctgcaggtgcgccaggtggaggactaccctgtagacctg
tactacctgatggacctctccctctccatgaaggatgacttggagaacatccggagcctg
ggcaccaagcttgcggaggaaatgaggaagctcactagtaacttccgcttaggtttcggg
tcttttgttgacaaggacatctctcctttctcctacacggcaccgagataccagaccaat
ccgtgtattggttacaagttattccccaactgcgtcccctccttcgggttccggcatctg
ctgcctctcacagacagagtcgacagcttcaacgaggaagtgaggaagcagagggtgtcc
cggaaccgagatgcccccgagggggggtttgatgcggtcctccaggctgctgtctgcaag
gagaagatcggatggcgaaaagatgctctgcacttgctggtgttcacaacagacgatgtg
ccccacatcgcactggatggaaaactgggtggcctggtccagccccacgatggccagtgt
cacctgaatgaagccaatgagtacacagcctctaaccagatggactatccatcgcttgcc
ttgcttggggagaagctggcagagaacaatatcaacctcatttttgctgtgacgaagaac
cactatatgctctacaagaattttacagccctgatacctggaaccactgtggagattttg
catggagattccaaaaatattattcaactgattatcaatgcgtacagtagcatccgggct
aaagtggagctgtcagtgtgggatcagccagaagaccttaatctcttcttcactgccacc
tgccaagatggcatatcttaccctggtcagaggaagtgtgagggtctgaagattggggac
acggcatcctttgaagtgtccgtggaggctcggagctgccccggcagacaagcagcacag
tctttcaccttgaggcccgtgggcttccgggacagtctgcaggtggaagtcgcctacaat
tgcacatgcggctgtagcacggggctggagcccaacagtgccagatgcagtgggaatgga
acatacacctgtgggctgtgcgagtgtgaccccggctacctgggcactaggtgcgagtgc
caggagggggagaaccagagcgggtaccagaacctgtgccgggaggcagagggcaagcct
ctgtgcagcgggcgtggagagtgtagctgcaaccagtgctcctgcttcgagagtgagttc
gggaggatctacggacctttctgcgagtgtgacagcttttcctgtgccagaaacaagggc
gtcctatgctcaggccatggagagtgtcactgtggagaatgcaaatgccacgcaggttac
attggggacaattgtaactgctcaacagacgtcagcacatgcagggccaaggatgggcag
atctgcagtgaccgaggccgttgtgtctgtgggcagtgccagtgcacagagcctggagcc
tttggggagacgtgtgagaagtgcccaacctgcccggatgcttgcagctctaagagagac
tgtgtcgaatgcttgctacttcaccaggggaaacctgacaaccagacctgccaccaccag
tgcaaagatgaggtgatcacgtgggtagacaccatcgtcaaagatgaccaggaggctgtg
ctttgcttctacaaaactgctaaggactgcgttatgatgttcagctacacagaactgccc
aatgggaggtccaacttgacggtcctccgggagccagaatgtggaagtgcccccaatgcc
atgaccatcctgctggctgtggttggcagcatcctcctgattgggatggcactcctggcc
atctggaagctgctcgtcaccatccacgaccgccgagagtttgccaagttccaaagtgag
cgctccagggcccgttatgaaatggcctcaaaccccctgtacagaaagcccatctccaca
cacactgtcgatttcgccttcaacaagttcaacaaatcctacaatggctcagtggactga

KEGG   Mus musculus (mouse): 16420
Entry
16420             CDS       T01002                                 

Gene name
Itgb6, 2210409C20Rik, 4831415H04Rik
Definition
(RefSeq) integrin beta 6
  KO
K06589  integrin beta 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16420 (Itgb6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16420 (Itgb6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16420 (Itgb6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16420 (Itgb6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16420 (Itgb6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16420 (Itgb6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16420 (Itgb6)
   05414 Dilated cardiomyopathy
    16420 (Itgb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16420 (Itgb6)
   04515 Cell adhesion molecules [BR:mmu04515]
    16420 (Itgb6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16420 (Itgb6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16420 (Itgb6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 16420
NCBI-ProteinID: NP_001153036
MGI: 96615
Ensembl: ENSMUSG00000026971
Vega: OTTMUSG00000012790
UniProt: Q9Z0T9
Position
2 C1.1- C1.2; 2 34.81 cM
AA seq 787 aa
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
AGLSSDG
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgtttctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggggtggtgcagaaagctgctcagactgcctgctcacaggaccccac
tgcgcctggtgctcccaggagaatttcacccacctgtctggagctggcgagaggtgcgac
accccagcgaatcttttagccaaaggatgtcaactacccttcattgaaaaccctgtctcc
cgcatagaagtccttcaaaataagcctctcagcgtgggccgacagaagaacagttctgac
attgttcagattgctcctcaaagcttggttcttaaattgagaccagggcgtgagcagact
ctgcaagtgcaggtccgccaaactgaagattacccagtagatctgtattacctcatggac
ctctccgcctctatggatgacgacctcaacaccatcaaagagcttggctcccggctggcc
aaagagatgtccaaactaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaaccccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattaactgatgatgcc
gagagattcaatgaaattgtgaggaaacagaagatttctgctaatattgacacacctgaa
ggtggatttgatgcaatcatgcaggctgctgtgtgtaaggaaaagattggctggcgcaat
gactcgctccacctcctggtttttgtgagtgatgccgattctcattttggaatggacagc
aagctggcaggcattgtcattcccaatgatggactctgtcacttggaccacaggaatgaa
tattccatgtcaactgtcttggaatatccaactatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcagtcacccaagaacaagtccatctgtatgagaac
tatgcaaaactcattcctggagcaaccgtgggactgcttcagaaggattctgggaacatc
cttcagctgatcatctccgcttatgaagaactgcggtctgaggtggaactggaagtgtta
ggggacacagaaggactcaacctgtctttcacagctctctgtaacaatggtgtcctcttc
ccacaccaaaagaaatgctcccacatgaaagttggagacacagcatccttcaatgtgact
gtgagcgtatccaactgtgagaaaagaagcaggaacctcatcataaagccagtggggctg
ggggacaccctagaaatactcgtcagtgcagaatgtgactgcgactgccagagagaaata
gaaactaacagctctaagtgtcacaatgggaatggctccttccagtgtggggtgtgtacc
tgcaaccccggccacatgggtcctcactgcgagtgtggtgaggatatggtgagcacggat
tcctgcaaggagtccccgggtcacccttcatgcagtggaaggggtgactgctattgtggg
cagtgcatctgccacttatcgccgtacggaagcatctacggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggccttctctgtggagataacggtgactgtgactgt
ggcgagtgtgtgtgccgggatggctggacaggtgaatactgtaactgtacaaccaacagg
gactcgtgtacatctgaggatggagtgctgtgcagtggacgtggggactgtgtctgtggc
aagtgtgtctgcagaaaccctggagcctcaggacccacctgtgaacgctgtcctacctgt
ggcgacccctgtaactctaaacggagttgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgtgctgacaagtgtaaagccattggtgccaccatcagtgaggaagat
ttttcaaaggatacttctgtctcctgctctctacaaggagaaaatgaatgccttattaca
ttcctaataactacggataatgaagggaaaaccatcattcacaacatcaatgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggcgatcctgctc
atcggagttgtgctactgtgcatttggaagctgctggtatcatttcatgaccggaaggaa
gttgctaaatttgaagcagaacgctctaaggccaagtggcaaacgggaaccaatcctctg
taccgaggttccaccagcacttttaagaacgtgacctacaagcacagggagaagcacaaa
gcaggcctttcctcagatgggtag

KEGG   Mus musculus (mouse): 16421
Entry
16421             CDS       T01002                                 

Gene name
Itgb7, Ly69
Definition
(RefSeq) integrin beta 7
  KO
K06590  integrin beta 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05202  Transcriptional misregulation in cancer
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16421 (Itgb7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16421 (Itgb7)
   04514 Cell adhesion molecules
    16421 (Itgb7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16421 (Itgb7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16421 (Itgb7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16421 (Itgb7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16421 (Itgb7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16421 (Itgb7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16421 (Itgb7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16421 (Itgb7)
   05414 Dilated cardiomyopathy
    16421 (Itgb7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16421 (Itgb7)
   04515 Cell adhesion molecules [BR:mmu04515]
    16421 (Itgb7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16421 (Itgb7)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16421 (Itgb7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 16421
NCBI-ProteinID: NP_038594
MGI: 96616
Ensembl: ENSMUSG00000001281
Vega: OTTMUSG00000030863
UniProt: P26011
Position
15 F2; 15 57.39 cM
AA seq 806 aa
MVDSSTVLIFLLVLGGGQSELDTKITSSGEAAEWEDPDLSLQGSCQPVPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPAQELEEPRGRQEVLQDKPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLHHPCPSRLERCQPPFSFHHVLSLTGDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELR
QLIPKSAVGELSEDSSNVVQLIMDAYDSLSSTVTLEHSPLPPGVSISFESHCKGPEKTEG
EAGDRGQCNDVRVNQTVDFWVTLQATHCLPEAHVLRLWALGFSEELTVELHTVCDCNCGD
AQPHAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANHTGRACECSK
SVDSCVSPEGGLCSGHGYCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGTG
PLAANCSVVCADVNVTLTLAPNLDDGWCKERTIDNQLFFFLVEHAASGIVLRVRPQEKGV
DHTRAIILGCTGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKEQQQLNWKQDNNPLYKSA
ITTTVNPRFQGTNGRSPSLSLTREAD
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggtggattcatcaactgttctcatttttctgctggttctgggcggaggtcagagtgag
ttagataccaagattacatcctctggggaggccgcagaatgggaggatcctgacctgtct
ctgcagggatcctgccagccagttccttcctgccagaagtgtattctctcacatcccagc
tgtgcatggtgcaaacaactgaacttcactgcctcgggagaggcagaggcgaggcgctgc
gcgcggcgagaggagctactggctcgcgggtgccccgcgcaggagctagaggagccgaga
ggccgccaggaggtgctgcaggacaagccgctcagccagggagatcgcggcgagggggcc
acccagctggccccgcagcggatccgcgtcacgctgcgaccaggggagccccagaaattc
cgggtccgcttcctccgagctgcggggtaccccgtggacctatattaccttatggacctg
agctactcaatgaaggacgacttggaacgtgtgcgccagctagggcatgccctgctggtc
aggctgcaggaggtcacacattctgtgcgcataggttttggctccttcgtggacaaaacg
gtgctgccctttgtaagcaccgtgccctccaagcttcaccacccatgccccagccgactg
gagcgttgtcagccacccttcagctttcaccacgtgctgtccctcaccggggacgctcaa
gccttcgagagagaggtgggacgccagaatgtctctggcaacctggactcacccgaaggc
ggctttgatgccattttgcaggctgccctctgccaggaacagattggctggagaaatgtc
tcccgtcttctagtgttcacttcagacgatacattccacacagctggggatgggaaactg
ggtggcattttcatgcccagcgacgggcggtgccatctggacagcaatggtgtctacacg
aacagcgcagagtttgactatccctctgtgggtcaagtagcccaggccctcactgcagcg
aatatccaacctatctttgctgtcaccggtgcaacactgcctgtgtatcaggagctgaga
cagttgattcccaagtctgctgtcggggagctgagtgaggactccagcaatgtggtgcag
ctcatcatggatgcttatgatagcctgtcatccactgtgactcttgagcactctccactc
ccaccaggagtcagcatctcctttgaatctcactgtaagggtcctgagaagacggagggt
gaggctggggaccggggacagtgcaatgatgtccgagtcaaccagacggtggatttctgg
gtcactcttcaagctactcactgcctcccagaagcccacgtcctacgactctgggctctt
ggcttctcagaggagttaactgtggagctgcacacagtgtgcgactgtaactgtggtgat
gcccagcctcacgctccctactgcagtgatggacagggggaccttcagtgcgggatatgc
agctgtgcccctggccgtcttggtcagctgtgtgaatgctctgaggctgacctgtcctcc
ccagatttggaatctggttgccgggccccaaacgggacagggcccctatgcagcgggaag
ggtcgatgccaatgtggacgctgcagctgcagtgggcagagctctgggcgtctgtgcgag
tgtgatgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggccactgc
cagtgtggagtatgtcactgtcacgccaaccacaccggcagagcttgcgagtgcagcaag
agtgtagacagctgtgtcagtcctgaaggagggctctgcagtgggcacggatactgcaaa
tgcaaccgttgccagtgcctggatggctactacggggctctgtgtgaccagtgcctaggc
tgcaagtcaccatgtgagcagtacagggattgtgcagagtgcggggcatttggtaccggt
cccctggcagccaactgtagtgtggtctgtgctgacgtgaatgtgaccttgaccttggcc
cctaacttggatgatggctggtgcaaagaaaggacaatagacaaccagctgttcttcttc
ctggtggagcatgcagccagcgggatcgtactgagagtgagaccccaagagaagggagtg
gatcacacccgtgccatcatactgggctgcacagggggcatcgtggcagtgggactaggg
ctggttctggcttaccggctctctgtggaaatctacgaccgacgggagtacaggcgcttt
gagaaggagcagcagcaactcaactggaagcaggacaacaatcctctctacaaaagtgcg
atcacaaccactgtcaacccccgcttccaagggacaaacggtcggtcgccatccctctct
ctgaccagggaagcagactga

KEGG   Mus musculus (mouse): 192897
Entry
192897            CDS       T01002                                 

Gene name
Itgb4, AA407042, C230078O20, CD104
Definition
(RefSeq) integrin beta 4
  KO
K06525  integrin beta 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    192897 (Itgb4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    192897 (Itgb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    192897 (Itgb4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    192897 (Itgb4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    192897 (Itgb4)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    192897 (Itgb4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    192897 (Itgb4)
   05414 Dilated cardiomyopathy
    192897 (Itgb4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    192897 (Itgb4)
   04515 Cell adhesion molecules [BR:mmu04515]
    192897 (Itgb4)
   04090 CD molecules [BR:mmu04090]
    192897 (Itgb4)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   192897 (Itgb4)
  Exosomal proteins of bladder cancer cells
   192897 (Itgb4)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   192897 (Itgb4)
CD molecules [BR:mmu04090]
 Proteins
  192897 (Itgb4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 192897
NCBI-ProteinID: NP_001005608
MGI: 96613
Ensembl: ENSMUSG00000020758
Vega: OTTMUSG00000003650
UniProt: A2A864
Position
11 E2; 11 80.91 cM
AA seq 1802 aa
MAGPCCSPWVKLLLLAAMLSASLPGDLANRCKKAQVKSCTECIRVDKSCAYCTDELFKER
RCNTQAELLAAGCRGESILVMESSLEITENTQIDTSLHRSQVSPQGLQVRLRPGEERSFV
FQVFEPLESPVDLYILMDFSNSMSDDLDNLKQMGQNLAKILRQLTSDYTIGFGKFVDKVS
VPQTDMRPEKLKEPWPNSDPPFSFKNVISLTENVEEFWNKLQGERISGNLDAPEGGFDAI
LQTAVCTRDIGWRADSTHLLVFSTESAFHYEADGANVLAGIMNRNDEKCHLDASGAYTQY
KTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHKYFPVSSLGVLQEDSSNIVELL
EEAFYRIRSNLDIRALDSPRGLRTEVTSDTLQKTETGSFHIKRGEVGTYNVHLRAVEDID
GTHVCQLAKEDQGGNIHLKPSFSDGLRMDASVICDVCPCELQKEVRSARCHFRGDFMCGH
CVCNEGWSGKTCNCSTGSLSDTQPCLREGEDKPCSGHGECQCGRCVCYGEGRYEGHFCEY
DNFQCPRTSGFLCNDRGRCSMGECVCEPGWTGRSCDCPLSNATCIDSNGGICNGRGYCEC
GRCHCNQQSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRACDDCPFKVKMV
DELKKEEVVEYCSFRDEDDDCTYSYNVEGDGSPGPNSTVLVHKKKDCPPGSFWWLIPLLI
FLLLLLALLLLLCWKYCACCKACLGLLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDTVRWKITNNVQRPGFATHAASTSPTELVPYGLSLRLGRLCTENLMKPGTRE
CDQLRQEVEENLNEVYRQVSGAHKLQQTKFRQQPNTGKKQDHTIVDTVLLAPRSAKQMLL
KLTEKQVEQGSFHELKVAPGYYTVTAEQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPVGTATLGRRLVNITIIKEQASGVVSFEQPEYSVSRGDQVARIPVIRHILDN
GKSQVSYSTQDNTAHGHRDYVPVEGELLFHPGETWKELQVKLLELQEVDSLLRGRQVRRF
QVQLSNPKFGARLGQPSTTTVILDETDRSLINQTLSSPPPPHGDLGAPQNPNAKAAGSRK
IHFNWLPPPGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQ
GEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNE
DNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKR
PMSIPIIPDIPIVDAQGGEDYENFLMYSDDVLRSPASSQRPSVSDDTEHLVNGRMDFAYP
GSANSLHRMTAANVAYGTHLSPHLSHRVLSTSSTLTRDYHSLTRTEHSHSGTLPRDYSTL
TSLSSQGLPPIWEDGRSRLPLSWTLGSLSRAHMKGVPASRGSPDSIILAGQSAAPSWGTD
SRGAVGVPDTPTRLVFSALGPTSLKVSWQEPQCDRMLLGYSVEYQLLNGGEMHRLNIPNP
GQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFTLST
PSAPGPLVFTALSPDSLQLSWERPRRPNGDILGYLVTCEMAQGGAPARTFRVDGDNPESR
LTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQVGGPFPQLGSHSGLFQNPVQSEF
SSVTSTHSTTTEPFLMDGLTLGTQRLEAGGSLTRHVTQEFVTRTLTASGSLSTHMDQQFF
QT
NT seq 5409 nt   +upstreamnt  +downstreamnt
atggcagggccctgttgcagcccatgggtgaagctgctgctgctggcagcaatgctgagt
gccagcctccctggagacctggccaaccgctgcaagaaggctcaggtgaagagctgtacc
gagtgcatccgggtggacaagagctgtgcctactgcacagacgagctgttcaaggagagg
cgctgcaacacccaggcggagcttctggctgcaggctgcaggggagagagcatcctggtc
atggagagcagccttgaaatcacagagaacacccagatcgacaccagcctgcaccgcagc
caggtatctccccaaggcctgcaagtccggctgcggccgggtgaggagcgcagctttgtg
ttccaggtgtttgagcccctggagagccccgtggatctgtatatcctcatggacttctcc
aactccatgtctgacgatctggacaacctcaagcagatggggcagaacctggccaagatc
ctgcgccagctcaccagcgactacaccattggatttggaaagtttgtggacaaagtcagc
gtcccacagacagacatgaggcccgagaaactgaaggagccctggcccaacagtgatccc
ccgttctccttcaagaacgttatcagcttaacggagaatgtggaagaattctggaacaaa
ctgcaaggagaacgcatctcaggcaacctggacgctcctgaagggggctttgatgccatc
ctgcagacagctgtgtgcacaagggacattggctggagggctgacagcacccacctgctg
gtgttctccaccgagtctgccttccactacgaggctgatggtgccaacgtgctggccggc
atcatgaaccgcaatgatgagaaatgccacctggacgcctcgggcgcctacacccaatac
aagacacaggactacccatcagtgcccacgctggttcgcctgcttgccaagcataacatc
atccccatctttgctgtcaccaactactcttacagctactatgagaagctccataagtat
ttccccgtctcctctctgggcgtcctgcaggaggattcatccaacatcgtggagctgctg
gaggaggccttctatcgaattcgctccaacctggacatccgggctctggacagccccaga
ggcctgagaacagaggtcacctccgatactctccagaagacggagactgggtcctttcac
atcaagcggggggaagtgggcacatacaatgtgcatctccgggcagtggaggacatagat
gggacacatgtgtgccagctggctaaagaagaccaagggggcaacatccacctgaaaccc
tccttctctgatggcctccggatggacgcgagtgtgatctgtgacgtgtgcccctgtgag
ctgcaaaaggaagttcgatcagctcgctgtcacttcagaggagacttcatgtgtggacac
tgtgtgtgcaatgagggctggagtggcaaaacctgcaactgctccaccggctctctgagt
gacacacagccctgcctgcgtgagggtgaggacaaaccgtgctcgggccacggcgagtgc
cagtgcggacgctgtgtgtgctatggtgaaggccgctacgagggtcacttctgcgagtat
gacaacttccagtgtccccggacctctggattcctgtgcaatgaccggggtcgctgttct
atgggagagtgtgtgtgtgagcctggttggacaggccgcagctgtgactgtcccctcagc
aatgccacctgcatcgatagcaacgggggcatctgcaacggccgaggctactgtgagtgt
ggccgttgtcactgcaaccagcagtcgctctacacggacaccacctgtgagatcaactac
tctgcgatacgcctgggtctctgtgaggatctccgctcctgcgtacagtgccaggcctgg
ggcaccggggagaagaaagggcgcgcgtgtgacgattgcccctttaaagtcaagatggta
gacgagcttaagaaagaagaggtggtggagtactgctccttccgggatgaggatgacgac
tgcacttacagctacaacgtggagggcgatggcagccctgggcccaacagcacagtcctg
gtccacaaaaagaaagactgccctcccggctccttctggtggctcatccccctgctcatc
ttcctcctgttgctcctggcgttgcttctgctgctctgctggaaatactgtgcctgctgc
aaagcctgcctggggcttcttccttgctgcaaccgaggtcacatggtgggctttaaggaa
gatcactatatgcttcgggagaacctgatggcctctgaccacctggacacgcccatgcta
cgaagcgggaacctcaagggacgagacacagtccgctggaagatcaccaacaatgtgcag
cgccctggctttgccacccatgccgccagcaccagccccacggagctcgtaccctacggg
ctgtccctgcgccttggccgcctctgcactgagaaccttatgaagccgggcacccgagag
tgtgaccagctacgccaggaggtggaggaaaatctgaatgaggtgtatagacaggtcagc
ggcgcacacaagctccagcagacgaagttccgacagcagcccaacaccgggaaaaagcaa
gaccacaccattgtggacacagtgttgctggcgccccgctccgccaagcagatgctgctg
aagctgacagagaagcaggtggagcaggggtccttccatgaactgaaggtggcccctggc
tactacactgtcacggcagagcaggatgcccggggcatggtggagttccaggagggcgtg
gagctggtggatgtgcgagtgcccctcttcatccggcctgaggatgatgatgagaagcag
ctgctggtggaggccattgatgtccctgtgggcactgccacccttggtcgccgtctggta
aacatcaccattatcaaggaacaagctagtggggtagtgtccttcgagcagcctgaatac
tcggtgagtcgtggagaccaggtggcccgcatccctgtcatccggcacatcctggacaat
ggcaagtcccaggtctcctatagcacacaggataatacagcacacggacaccgggattat
gtccctgtggagggagagctgctgttccatcctggggagacctggaaggagttgcaggtg
aagctactggagctgcaggaggtcgactccctcctgcgtggccgccaggtccgccgcttc
caagtccaactcagcaaccccaagttcggagcccgcctgggccagcccagcacaaccacc
gttattctcgatgaaacggacaggagtctcataaatcaaacactttcatcgcctccgcca
ccccatggagacctgggcgccccacagaaccccaatgccaaggctgccgggtccaggaag
atccatttcaactggctgccccctcctggcaagccaatggggtacagggtgaagtactgg
atccagggcgactctgagtctgaagcccaccttctagacagcaaggtgccctcagtggaa
ctcaccaacctgtatccctattgcgactacgaaatgaaggtgtgtgcctatggggcacag
ggtgaggggccctatagctcactggtgtcctgccgcacccaccaggaagtacccagcgag
ccagggaggctggctttcaatgtagtctcttctacggtgacgcagctgagctgggcagag
ccagctgagaccaatggcgagatcacagcctacgaggtctgctatggactggtcaatgag
gacaaccgacccattggacctatgaagaaggtgctcgtggacaaccccaagaaccggatg
ctgctcattgagaatctgcgagaatcccagccataccgatacacggttaaggcgcgcaat
ggggcaggatggggacccgagagagaggctatcatcaacctggctacacagcccaagcgg
cccatgtccatccctatcatcccagacatccccatagtggacgcccagggtggagaagac
tacgaaaacttccttatgtacagtgatgacgtcctgcggtccccagccagcagccagagg
cccagcgtttctgatgacactgagcacctggtgaatggccggatggactttgcctatcca
ggcagcgccaactccctgcacagaatgactgcagccaatgtggcctatggcacgcatctg
agcccacacctgtcccaccgagtgctgagcacgtcctccacccttacccgggactaccac
tctctgacacgcacagagcactcccactcaggcacacttcccagggactactccaccctc
acttccctttcctcccaaggcctccctcctatctgggaagatgggaggagcaggcttccg
ctgtcctggactcttgggtccttgagccgggctcacatgaagggtgtgcccgcatccagg
ggttcaccagactctataatcctggccgggcagtcagcagcaccctcctggggtacagat
tcccgtggggctgtgggtgtgcctgacacacccactcggctggtgttctctgccctgggg
cccacgtctttgaaggtgagctggcaggagccacagtgtgatcggatgctgctgggctac
agtgtggaataccagctactaaacggcggcgagatgcatcggctcaacatccctaaccct
ggccaaacctcggtggtggtagaggatctcctgcctaaccactcctatgtgttccgggta
cgggcccagagccaggagggctggggccgagagcgagagggtgtcatcaccatcgagtcc
caggtgcacccgcagagccctctctgccccctgccaggctcagccttcactctgagcacc
cccagcgccccgggaccgctggtgttcactgccctaagcccagactccctgcagctcagc
tgggagcggccgaggaggcccaatggagatatccttggctacctggtgacctgtgagatg
gcccaaggaggagcaccagccaggaccttccgggtggacggagacaaccctgagagccgg
ttgactgtacctggcctcagtgagaacgttccttacaagttcaaggttcaggccaggacg
accgagggcttcgggccagagcgtgagggtatcatcaccatcgagtctcaggttggaggc
cccttcccacagctgggcagccattctgggctcttccagaacccagtgcaaagcgagttc
agcagcgtgaccagcacgcacagcaccacgactgagcccttcctcatggatggtctaacc
ctggggacccagcgcctggaagcaggaggctccctcacccggcatgtgacccaggaattc
gtgacccggaccttaacggccagtggctctctcagcactcatatggaccaacagttcttc
caaacctga

KEGG   Mus musculus (mouse): 320910
Entry
320910            CDS       T01002                                 

Gene name
Itgb8, 4832412O06Rik
Definition
(RefSeq) integrin beta 8
  KO
K06591  integrin beta 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    320910 (Itgb8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    320910 (Itgb8)
   04514 Cell adhesion molecules
    320910 (Itgb8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    320910 (Itgb8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    320910 (Itgb8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    320910 (Itgb8)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    320910 (Itgb8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    320910 (Itgb8)
   05414 Dilated cardiomyopathy
    320910 (Itgb8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    320910 (Itgb8)
   04515 Cell adhesion molecules [BR:mmu04515]
    320910 (Itgb8)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   320910 (Itgb8)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   320910 (Itgb8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Other DBs
NCBI-GeneID: 320910
NCBI-ProteinID: NP_796264
MGI: 1338035
Ensembl: ENSMUSG00000025321
Vega: OTTMUSG00000026449
UniProt: Q0VBD0
Position
12; 12 F2
AA seq 767 aa
MCGSALAFLTAALLSLHNCQRGPALVLGAAWVFSLVLGLGQSEHNRCGSANVVSCARCLQ
LGPECGWCVQEDFVSGGSGSERCDTVSSLISKGCPVDSIEYLSVHVVTSSENEINTQVTP
GEVSVQLHPGAEANFMLKVRPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSKKMALY
SRDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKA
VHRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIV
VPNDGNCHLKNNVYVKSTTMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPG
AIAGEIESKAANLNNLVVEAYKKIISEVKVQLENQVHGVHFNITAICPDGARKPGISGCG
NVTSNDEVLFNVTVVMKTCDIMGGKNYAIIKPIGFNETTKVHIHRSCSCQCENHRGLKGQ
CAEAAPDPKCPQCDDSRCHFDEDQFPSETCKPQEDQPVCSGRGVCICGKCLCHKTKLGRV
YGQYCEKDDFSCPYLHGDVCAGHGECEGGRCQCFSGWEGDRCQCPSASAQHCVNSKGQVC
SGRGTCVCGRCECTDPRSIGRLCEHCPTCHLSCSENWNCLQCLHPHNLSQAALDQCKSSC
AVMEQHRMDQTSECLSGPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNNNKIKSSSDY
RMSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAQEAFRCNF
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtgcggctcggccctggcttttctgactgctgcactgctctctctgcacaactgccag
cgaggtccagccttggttcttggggcagcctgggtattttcacttgttctcggactgggc
caaagtgaacacaatagatgtggctctgcaaatgtggtctcctgtgccaggtgcctccag
ctgggtccggaatgcggatggtgtgttcaagaggattttgtttcaggtggatcaggaagt
gaacgttgtgatactgtttccagtttgataagcaaaggctgtccagttgattcaatagaa
tacctgtctgtgcatgttgtaacgtcaagtgagaatgaaatcaatacccaggtgacaccg
ggagaagtctcagtccaactgcatccaggagctgaagctaattttatgttaaaagtccgt
cctctgaagaaataccccgtggatctttattatctggttgatgtgtcagcatcaatgcac
aataatatagaaaaattgaattccgttggaaatgatttatctaaaaaaatggccctttat
tcccgtgacttccgtcttggttttggctcatatgtggataaaactgtctcgccatacatt
agtatccacccggaaaggatccacaatcagtgcagtgactacaatttagactgtatgcct
ccccatggatacattcatgtgctgtctctgacagaaaacatcactgagtttgaaaaagca
gtccacagacaaaagatctctggaaacatagacacccctgaaggaggttttgatgccatg
cttcaggctgccgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctg
ctggtgatgacagaccagacatcacatcttgctcttgacagcaaattggcaggcatagtg
gtgccgaatgacggaaactgccatctcaaaaacaatgtctacgtcaaatcgacaaccatg
gaacatccgtcattaggccaactttctgaaaagttaatagacaacaacataaatgtcatt
tttgcagttcaaggaaagcagtttcattggtacaaggaccttctgccccttttgcctggt
gccattgctggtgaaatagaatccaaagctgcaaatctcaacaatttagtagtagaagcc
tacaagaagattatctcagaagtaaaagtgcagctggaaaaccaggtacacggtgtccat
tttaacatcactgccatctgtccagatggggccagaaagccaggcataagtgggtgtgga
aacgtgacaagcaatgacgaagttcttttcaatgtaactgttgtgatgaaaacatgtgat
atcatgggaggaaaaaactatgcaataatcaagcctattggtttcaatgaaaccactaaa
gtccacatacacagaagctgcagttgccagtgtgagaaccacagaggactcaaaggacag
tgtgcggaagctgccccagaccccaagtgtccacagtgtgatgacagcagatgtcatttt
gatgaagaccagtttccttctgaaacttgcaagccacaggaggatcaacctgtctgcagt
ggccgaggtgtttgcatctgtgggaaatgtttatgtcacaaaaccaagctaggaagagtg
tatggccagtactgtgagaaggatgacttctcctgtccctatctccatggggatgtgtgt
gctgggcatggggagtgtgaaggtggcagatgccagtgctttagtggctgggaaggagat
cggtgtcagtgcccatcagcctcagcacagcactgtgtcaactccaagggccaagtttgc
agcgggagaggcacctgcgtgtgtggcaggtgtgagtgtactgatcccagaagcattggc
cgtctctgtgagcactgcccaacctgccatctctcctgcagtgaaaactggaattgtctg
cagtgccttcaccctcacaatctgtctcaggctgcccttgatcagtgtaaatcctcctgt
gctgtcatggaacagcatcgcatggaccaaacatcagaatgtttatctggcccaagctat
ctgcgaatatttttcatcatattcatagtcacattcttgatcgggttgcttaaagttctt
atcattagacaagtgatactacaatggaataataataaaataaagtcctcatcagattat
agaatgtctgcttctaaaaaggataaactgattctgcaaagtgtttgcacgagagctgta
acctaccgacgagaaaagcctgaggaaataaaaatggatatcagcaaactaaatgctcag
gaggccttcaggtgcaacttctaa

DBGET integrated database retrieval system