KEGG   Mus musculus (house mouse): 16415
Entry
16415             CDS       T01002                                 
Symbol
Itgb2l, 5033406G21Rik, pactolus
Name
(RefSeq) integrin beta 2-like
  KO
K06464  integrin beta 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04390  Hippo signaling pathway
mmu04514  Cell adhesion molecules
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05140  Leishmaniasis
mmu05144  Malaria
mmu05146  Amoebiasis
mmu05150  Staphylococcus aureus infection
mmu05152  Tuberculosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05323  Rheumatoid arthritis
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16415 (Itgb2l)
   04390 Hippo signaling pathway
    16415 (Itgb2l)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    16415 (Itgb2l)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16415 (Itgb2l)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16415 (Itgb2l)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16415 (Itgb2l)
   04613 Neutrophil extracellular trap formation
    16415 (Itgb2l)
   04650 Natural killer cell mediated cytotoxicity
    16415 (Itgb2l)
   04670 Leukocyte transendothelial migration
    16415 (Itgb2l)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16415 (Itgb2l)
  09171 Infectious disease: bacterial
   05133 Pertussis
    16415 (Itgb2l)
   05134 Legionellosis
    16415 (Itgb2l)
   05150 Staphylococcus aureus infection
    16415 (Itgb2l)
   05152 Tuberculosis
    16415 (Itgb2l)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    16415 (Itgb2l)
   05144 Malaria
    16415 (Itgb2l)
   05140 Leishmaniasis
    16415 (Itgb2l)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16415 (Itgb2l)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    16415 (Itgb2l)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16415 (Itgb2l)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16415 (Itgb2l)
   04515 Cell adhesion molecules [BR:mmu04515]
    16415 (Itgb2l)
   04090 CD molecules [BR:mmu04090]
    16415 (Itgb2l)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16415 (Itgb2l)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16415 (Itgb2l)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16415 (Itgb2l)
CD molecules [BR:mmu04090]
 Proteins
  16415 (Itgb2l)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 I-EGF_1 Tmemb_9
Other DBs
NCBI-GeneID: 16415
NCBI-ProteinID: NP_032431
MGI: 1277979
Ensembl: ENSMUSG00000000157
UniProt: Q3UV74
Structure
Position
16:complement(96223488..96244861)
AA seq 738 aa
MLGQCTLLPVLAGLLSLESALSQLCTKDNVSTCQDCIRSGPSCAWCQKLNFTGRGEPDSV
RCDTPEQLLLKGCTSEYLVDPKSLAESQEDKERDQRQLSPRNVTVFLRPGQAATFKVDFQ
RTQDNSVDLYFLMGLSGSAQGHLSNVQTLGSDLLKALNEISRSGRIGFGSIVNMTFQHIL
KLTADSSQFQRELRKQLVSGKLATPKGQLDAVVQVAICLGEIGWRNGTRFLVLVTDNDFH
LAKDKTLGTRQNTSDGRCHLDDGMYRSRGEPDYQSVVQLASKLAENNIQPIFVVPSRMVK
TYEKLTTFIPKLTIGELSDDSSNVAQLIRNAYSKLSSIVVLNHSTIPSILKVTYDSYCSN
GTSNPGKPSGDCSGVQINDQVTFQVNITASECFREQFFFIQALGFMDSVTVRVLPLCECQ
CQEQSQHHSLCGGKGAMECGICRCNSGYAGKNCECQTQGPSSQDLEGSCRKDNSSIMCSG
LGDCICGQCECHTSDIPNKEIYGQYCECNNVNCERYDGQVCGGPERGHCSCGRCFCRYGF
VGSACQCRMSTSGCLNNRMVECSGHGRCYCNRCLCDPGYQPPLCEKRPGYFHRCSEYYSC
ARCLKDNSAIKCRECWNLLFSNTPFSNKTCMTERDSEGCWTTYTLYQPDQSDINSIYIKE
SLVCAEISNTTILLGVIVGVLLAVIFLLVYCMVYLKGTQKAAKLPRKGGAQSTLAQQPHF
QEPHHVEPVWNQERQGTQ
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgctgggccagtgcactctgctacctgtcctagctgggctgctgtctctggaatctgca
ctgtctcagttgtgtaccaaggacaatgtgagcacctgtcaggactgtatccggtcaggg
cccagctgtgcctggtgccagaagctgaacttcacagggcgaggggagcccgactcagtt
cgctgtgatacaccagagcaactgttgctaaaaggctgcacatctgagtacctcgtggac
cccaagagtcttgctgaatcccaggaagacaaggagagggaccagaggcagctgtctcca
cgaaatgtgacagttttcttaagaccgggtcaagcggcaacattcaaagtggacttccag
cggacccaggacaactctgttgacctgtacttcctgatgggcctctctggctctgcgcaa
ggccacctctccaatgtccagacactgggcagtgacctgctcaaagccctcaatgagatc
tccaggtcaggccgaatcggctttggatccattgtgaacatgaccttccagcacatcctg
aagctgactgcggactccagccaatttcagagggagctgaggaagcaactggtttctgga
aagctggctacccccaagggacagctggatgctgtggttcaagttgccatatgcctggga
gaaatcggctggcgcaatgggacccgatttctggtgcttgttactgacaacgatttccac
ttggctaaagacaagactctgggtaccagacagaacaccagcgatggtcgctgtcacctg
gacgacggcatgtacaggagcaggggagaacctgactaccagtcagtggtccagctggca
agcaaactggctgaaaacaacatccagcccatcttcgtggtgccctcaaggatggtgaaa
acctatgagaaacttaccacattcatccccaagctgaccattggggagctgtcagatgac
tccagcaacgtggcacagctcatcaggaacgcctacagtaaactctcctccattgttgtg
ctgaaccacagcaccatccccagcatcctgaaagttacctacgactcctactgcagcaat
ggaacatcaaatccaggcaaacccagcggggactgcagtggtgtacagatcaatgaccag
gtcaccttccaggttaacatcacagcttcagagtgcttccgggagcagttctttttcatc
caggcactgggcttcatggattcagtgaccgtgcgggtccttcccctgtgtgagtgccag
tgccaggagcagagtcaacaccacagcctctgtggaggcaagggagccatggagtgtggc
atctgcaggtgcaactctggctacgctgggaaaaactgtgagtgccagacacagggcccg
agcagccaggatctggagggaagctgccggaaggacaatagttccatcatgtgctcgggg
ctgggagactgtatctgtgggcagtgtgagtgccacaccagtgacatccccaacaaagag
atctatgggcaatactgcgagtgcaacaatgtcaactgtgagagatatgatggccaagtc
tgcggtggcccagaaagaggccactgctcctgtggccgatgcttttgtcgttacggcttc
gtgggctcagcctgccagtgccggatgtccacttcaggctgtctgaacaacaggatggtg
gagtgcagtggccatggtcgatgctactgtaacagatgcctctgtgacccgggctaccag
ccaccactgtgtgagaagcgtcctggctatttccatcgctgctccgagtactactcctgt
gccaggtgcttgaaagacaacagtgcaataaaatgcagagagtgttggaatctgctgttt
tccaacacccccttcagtaacaagacctgcatgactgaacgggactcagagggctgttgg
acaacctacactctatatcagccagaccagagtgacatcaattccatctacataaaggag
agcctagtgtgtgcagaaatctccaataccaccatcctactgggcgttatagtgggcgtc
ttgctggctgttatcttcctgctggtttactgtatggtttacctgaagggaacccagaag
gctgccaagctccccagaaagggtggggctcaaagcacactggcacagcagcctcatttc
caagaaccccaccatgtggagccagtgtggaatcaagagagacagggtacccaatga

DBGET integrated database retrieval system