KEGG   Mus musculus (mouse): 16418
Entry
16418             CDS       T01002                                 

Symbol
Eif6, 1110004P11, AA408895, CAB, Itgb4bp, eIF-6, imc-415, p27(BBP), p27BBP
Name
(RefSeq) eukaryotic translation initiation factor 6
  KO
K03264  translation initiation factor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    16418 (Eif6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mmu03009]
    16418 (Eif6)
   03012 Translation factors [BR:mmu03012]
    16418 (Eif6)
Ribosome biogenesis [BR:mmu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    16418 (Eif6)
Translation factors [BR:mmu03012]
 Eukaryotic type
  Initiation factors
   eIF-6
    16418 (Eif6)
SSDB
Motif
Pfam: eIF-6
Other DBs
NCBI-GeneID: 16418
NCBI-ProteinID: NP_034709
MGI: 1196288
Ensembl: ENSMUSG00000027613
Vega: OTTMUSG00000016192
UniProt: O55135 Q545K4
Position
2:complement(155661757..155668845)
AA seq 245 aa
MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIG
RMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPD
LDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVP
LVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAKPSTIATSMRDSL
IDSLT
NT seq 738 nt   +upstreamnt  +downstreamnt
atggcggtcagagcgtcgttcgagaacaactgtgaggtcggttgttttgccaaactcaca
aacgcctactgcctggtggccatcggaggctcagagaacttctatagtgtgttcgagggt
gagctctccgatgccattcccgtggtgcacgcatccatcgccggctgccgaatcatcggg
cgcatgtgtgtggggaacaggcatgggctcctggtacccaacaacaccaccgaccaggag
ctgcagcacatccgcaacagcctgcctgactccgtgcagatacggcgggtggaggagcgg
ctctcggcccttggcaatgtcaccacctgcaatgactatgtggccttggtccacccagac
ttggacagggagacagaagagatcctggctgatgtcctcaaggtggaagtcttcagacag
acagttgctgaccaggtgctagtaggaagctactgtgtcttcagtaatcagggggggctg
gtgcaccctaaaacttctatcgaggaccaggatgagttgtcctcccttcttcaggtcccc
cttgtggcaggcactgtgaaccgagggagtgaggtgattgctgctgggatggtggtgaac
gattggtgtgctttctgtggtctggacacgaccagcacggagctgtcagtggtggagagc
gtcttcaagctgaatgaagccaagccaagtaccattgccaccagcatgcgggattccctc
attgacagcctcacatga

DBGET integrated database retrieval system