KEGG   Mus musculus (mouse): 16420
Entry
16420             CDS       T01002                                 

Gene name
Itgb6, 2210409C20Rik, 4831415H04Rik
Definition
(RefSeq) integrin beta 6
  KO
K06589  integrin beta 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16420 (Itgb6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16420 (Itgb6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16420 (Itgb6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16420 (Itgb6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16420 (Itgb6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    16420 (Itgb6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    16420 (Itgb6)
   05414 Dilated cardiomyopathy
    16420 (Itgb6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16420 (Itgb6)
   04515 Cell adhesion molecules [BR:mmu04515]
    16420 (Itgb6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   16420 (Itgb6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16420 (Itgb6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 16420
NCBI-ProteinID: NP_001153036
MGI: 96615
Ensembl: ENSMUSG00000026971
Vega: OTTMUSG00000012790
UniProt: Q9Z0T9
Position
2 C1.1- C1.2; 2 34.81 cM
AA seq 787 aa
MGIELVCLFLLLLGRNDHVQGGCAWGGAESCSDCLLTGPHCAWCSQENFTHLSGAGERCD
TPANLLAKGCQLPFIENPVSRIEVLQNKPLSVGRQKNSSDIVQIAPQSLVLKLRPGREQT
LQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLAKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEITNPCSSIPYFCLPTFGFKHILPLTDDAERFNEIVRKQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDHRNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTALCNNGVLFPHQKKCSHMKVGDTASFNVT
VSVSNCEKRSRNLIIKPVGLGDTLEILVSAECDCDCQREIETNSSKCHNGNGSFQCGVCT
CNPGHMGPHCECGEDMVSTDSCKESPGHPSCSGRGDCYCGQCICHLSPYGSIYGPYCQCD
NFSCLRHKGLLCGDNGDCDCGECVCRDGWTGEYCNCTTNRDSCTSEDGVLCSGRGDCVCG
KCVCRNPGASGPTCERCPTCGDPCNSKRSCIECYLSADGQAQEECADKCKAIGATISEED
FSKDTSVSCSLQGENECLITFLITTDNEGKTIIHNINEKDCPKPPNIPMIMLGVSLAILL
IGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKHK
AGLSSDG
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggggattgagctggtctgcctgtttctgctacttctaggaaggaatgatcacgtccaa
ggtggctgtgcctggggtggtgcagaaagctgctcagactgcctgctcacaggaccccac
tgcgcctggtgctcccaggagaatttcacccacctgtctggagctggcgagaggtgcgac
accccagcgaatcttttagccaaaggatgtcaactacccttcattgaaaaccctgtctcc
cgcatagaagtccttcaaaataagcctctcagcgtgggccgacagaagaacagttctgac
attgttcagattgctcctcaaagcttggttcttaaattgagaccagggcgtgagcagact
ctgcaagtgcaggtccgccaaactgaagattacccagtagatctgtattacctcatggac
ctctccgcctctatggatgacgacctcaacaccatcaaagagcttggctcccggctggcc
aaagagatgtccaaactaaccagcaactttagactgggctttggctcttttgtggaaaag
cccgtttctccttttatgaaaacaaccccagaggaaatcaccaacccttgcagtagtatc
ccctatttctgcttacctacatttggattcaagcacattttgccattaactgatgatgcc
gagagattcaatgaaattgtgaggaaacagaagatttctgctaatattgacacacctgaa
ggtggatttgatgcaatcatgcaggctgctgtgtgtaaggaaaagattggctggcgcaat
gactcgctccacctcctggtttttgtgagtgatgccgattctcattttggaatggacagc
aagctggcaggcattgtcattcccaatgatggactctgtcacttggaccacaggaatgaa
tattccatgtcaactgtcttggaatatccaactatcggccaactcattgataaactggta
caaaacaacgtgctactgatctttgcagtcacccaagaacaagtccatctgtatgagaac
tatgcaaaactcattcctggagcaaccgtgggactgcttcagaaggattctgggaacatc
cttcagctgatcatctccgcttatgaagaactgcggtctgaggtggaactggaagtgtta
ggggacacagaaggactcaacctgtctttcacagctctctgtaacaatggtgtcctcttc
ccacaccaaaagaaatgctcccacatgaaagttggagacacagcatccttcaatgtgact
gtgagcgtatccaactgtgagaaaagaagcaggaacctcatcataaagccagtggggctg
ggggacaccctagaaatactcgtcagtgcagaatgtgactgcgactgccagagagaaata
gaaactaacagctctaagtgtcacaatgggaatggctccttccagtgtggggtgtgtacc
tgcaaccccggccacatgggtcctcactgcgagtgtggtgaggatatggtgagcacggat
tcctgcaaggagtccccgggtcacccttcatgcagtggaaggggtgactgctattgtggg
cagtgcatctgccacttatcgccgtacggaagcatctacggaccttactgccagtgtgac
aacttctcctgtctgagacacaaaggccttctctgtggagataacggtgactgtgactgt
ggcgagtgtgtgtgccgggatggctggacaggtgaatactgtaactgtacaaccaacagg
gactcgtgtacatctgaggatggagtgctgtgcagtggacgtggggactgtgtctgtggc
aagtgtgtctgcagaaaccctggagcctcaggacccacctgtgaacgctgtcctacctgt
ggcgacccctgtaactctaaacggagttgcatcgagtgctacctgtctgcagatggccag
gcccaagaagagtgtgctgacaagtgtaaagccattggtgccaccatcagtgaggaagat
ttttcaaaggatacttctgtctcctgctctctacaaggagaaaatgaatgccttattaca
ttcctaataactacggataatgaagggaaaaccatcattcacaacatcaatgaaaaagac
tgccccaaacctccaaacattcccatgatcatgttgggggtgtcactggcgatcctgctc
atcggagttgtgctactgtgcatttggaagctgctggtatcatttcatgaccggaaggaa
gttgctaaatttgaagcagaacgctctaaggccaagtggcaaacgggaaccaatcctctg
taccgaggttccaccagcacttttaagaacgtgacctacaagcacagggagaagcacaaa
gcaggcctttcctcagatgggtag

DBGET integrated database retrieval system