KEGG   Mus musculus (mouse): 16421Help
Entry
16421             CDS       T01002                                 

Gene name
Itgb7, Ly69
Definition
(RefSeq) integrin beta 7
  KO
K06590  integrin beta 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05202  Transcriptional misregulation in cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16421 (Itgb7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16421 (Itgb7)
   04514 Cell adhesion molecules (CAMs)
    16421 (Itgb7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16421 (Itgb7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16421 (Itgb7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    16421 (Itgb7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    16421 (Itgb7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16421 (Itgb7)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16421 (Itgb7)
   05414 Dilated cardiomyopathy (DCM)
    16421 (Itgb7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16421 (Itgb7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16421 (Itgb7)
   04515 Cell adhesion molecules [BR:mmu04515]
    16421 (Itgb7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16421 (Itgb7)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16421 (Itgb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Motif
Other DBs
NCBI-GeneID: 16421
NCBI-ProteinID: NP_038594
MGI: 96616
Ensembl: ENSMUSG00000001281
Vega: OTTMUSG00000030863
UniProt: P26011
Position
15 F3; 15 57.39 cM
AA seq 806 aa AA seqDB search
MVDSSTVLIFLLVLGGGQSELDTKITSSGEAAEWEDPDLSLQGSCQPVPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPAQELEEPRGRQEVLQDKPLSQGDRGEGA
TQLAPQRIRVTLRPGEPQKFRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLHHPCPSRLERCQPPFSFHHVLSLTGDAQ
AFEREVGRQNVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGRCHLDSNGVYTNSAEFDYPSVGQVAQALTAANIQPIFAVTGATLPVYQELR
QLIPKSAVGELSEDSSNVVQLIMDAYDSLSSTVTLEHSPLPPGVSISFESHCKGPEKTEG
EAGDRGQCNDVRVNQTVDFWVTLQATHCLPEAHVLRLWALGFSEELTVELHTVCDCNCGD
AQPHAPYCSDGQGDLQCGICSCAPGRLGQLCECSEADLSSPDLESGCRAPNGTGPLCSGK
GRCQCGRCSCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANHTGRACECSK
SVDSCVSPEGGLCSGHGYCKCNRCQCLDGYYGALCDQCLGCKSPCEQYRDCAECGAFGTG
PLAANCSVVCADVNVTLTLAPNLDDGWCKERTIDNQLFFFLVEHAASGIVLRVRPQEKGV
DHTRAIILGCTGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKEQQQLNWKQDNNPLYKSA
ITTTVNPRFQGTNGRSPSLSLTREAD
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggtggattcatcaactgttctcatttttctgctggttctgggcggaggtcagagtgag
ttagataccaagattacatcctctggggaggccgcagaatgggaggatcctgacctgtct
ctgcagggatcctgccagccagttccttcctgccagaagtgtattctctcacatcccagc
tgtgcatggtgcaaacaactgaacttcactgcctcgggagaggcagaggcgaggcgctgc
gcgcggcgagaggagctactggctcgcgggtgccccgcgcaggagctagaggagccgaga
ggccgccaggaggtgctgcaggacaagccgctcagccagggagatcgcggcgagggggcc
acccagctggccccgcagcggatccgcgtcacgctgcgaccaggggagccccagaaattc
cgggtccgcttcctccgagctgcggggtaccccgtggacctatattaccttatggacctg
agctactcaatgaaggacgacttggaacgtgtgcgccagctagggcatgccctgctggtc
aggctgcaggaggtcacacattctgtgcgcataggttttggctccttcgtggacaaaacg
gtgctgccctttgtaagcaccgtgccctccaagcttcaccacccatgccccagccgactg
gagcgttgtcagccacccttcagctttcaccacgtgctgtccctcaccggggacgctcaa
gccttcgagagagaggtgggacgccagaatgtctctggcaacctggactcacccgaaggc
ggctttgatgccattttgcaggctgccctctgccaggaacagattggctggagaaatgtc
tcccgtcttctagtgttcacttcagacgatacattccacacagctggggatgggaaactg
ggtggcattttcatgcccagcgacgggcggtgccatctggacagcaatggtgtctacacg
aacagcgcagagtttgactatccctctgtgggtcaagtagcccaggccctcactgcagcg
aatatccaacctatctttgctgtcaccggtgcaacactgcctgtgtatcaggagctgaga
cagttgattcccaagtctgctgtcggggagctgagtgaggactccagcaatgtggtgcag
ctcatcatggatgcttatgatagcctgtcatccactgtgactcttgagcactctccactc
ccaccaggagtcagcatctcctttgaatctcactgtaagggtcctgagaagacggagggt
gaggctggggaccggggacagtgcaatgatgtccgagtcaaccagacggtggatttctgg
gtcactcttcaagctactcactgcctcccagaagcccacgtcctacgactctgggctctt
ggcttctcagaggagttaactgtggagctgcacacagtgtgcgactgtaactgtggtgat
gcccagcctcacgctccctactgcagtgatggacagggggaccttcagtgcgggatatgc
agctgtgcccctggccgtcttggtcagctgtgtgaatgctctgaggctgacctgtcctcc
ccagatttggaatctggttgccgggccccaaacgggacagggcccctatgcagcgggaag
ggtcgatgccaatgtggacgctgcagctgcagtgggcagagctctgggcgtctgtgcgag
tgtgatgatgccagctgtgagcgacatgagggcatcctctgtggaggctttggccactgc
cagtgtggagtatgtcactgtcacgccaaccacaccggcagagcttgcgagtgcagcaag
agtgtagacagctgtgtcagtcctgaaggagggctctgcagtgggcacggatactgcaaa
tgcaaccgttgccagtgcctggatggctactacggggctctgtgtgaccagtgcctaggc
tgcaagtcaccatgtgagcagtacagggattgtgcagagtgcggggcatttggtaccggt
cccctggcagccaactgtagtgtggtctgtgctgacgtgaatgtgaccttgaccttggcc
cctaacttggatgatggctggtgcaaagaaaggacaatagacaaccagctgttcttcttc
ctggtggagcatgcagccagcgggatcgtactgagagtgagaccccaagagaagggagtg
gatcacacccgtgccatcatactgggctgcacagggggcatcgtggcagtgggactaggg
ctggttctggcttaccggctctctgtggaaatctacgaccgacgggagtacaggcgcttt
gagaaggagcagcagcaactcaactggaagcaggacaacaatcctctctacaaaagtgcg
atcacaaccactgtcaacccccgcttccaagggacaaacggtcggtcgccatccctctct
ctgaccagggaagcagactga

DBGET integrated database retrieval system