KEGG   Mus musculus (mouse): 16423
Entry
16423             CDS       T01002                                 

Gene name
Cd47, 9130415E20Rik, AA407862, AI848868, AW108519, B430305P08Rik, IAP, It, Itgp
Definition
(RefSeq) CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
  KO
K06266  CD47 antigen (Rh-related antigen, integrin-associated signal transducer)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16423 (Cd47)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mmu04515]
    16423 (Cd47)
   04090 CD molecules [BR:mmu04090]
    16423 (Cd47)
Cell adhesion molecules [BR:mmu04515]
 Immunoglobulin superfamily
  CD47
   16423 (Cd47)
CD molecules [BR:mmu04090]
 Proteins
  16423 (Cd47)
SSDB
Motif
Pfam: CD47 V-set_CD47 DUF962
Other DBs
NCBI-GeneID: 16423
NCBI-ProteinID: NP_034711
MGI: 96617
Ensembl: ENSMUSG00000055447
Vega: OTTMUSG00000014965
UniProt: Q61735
Position
16; 16 B5
AA seq 324 aa
MWPLAAALLLGSCCCGSAQLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKL
NKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSRE
GKTVIELKNRTAFNTDQGSACSYEEEKGGCKLVSWFSPNEKILIVIFPILAILLFWGKFG
ILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPGEKPVKNASGLGLIVISTGILI
LLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCIMACEPVHGPLLISGLGIIALA
ELLGLVYMKFVASNQRTIQPPRNR
NT seq 975 nt   +upstreamnt  +downstreamnt
atgtggcccttggcggcggcgctgttgctgggctcctgctgctgcggttcagctcaacta
ctgtttagtaacgtcaactccatagagttcacttcatgcaatgaaactgtggtcatccct
tgcatcgtccgtaatgtggaggcgcaaagcaccgaagaaatgtttgtgaagtggaagttg
aacaaatcgtatattttcatctatgatggaaataaaaatagcactactacagatcaaaac
tttaccagtgcaaaaatctcagtctcagacttaatcaatggcattgcctctttgaaaatg
gataagcgcgatgccatggtgggaaactacacttgcgaagtgacagagttatccagagaa
ggcaaaacagttatagagctgaaaaaccgcacggccttcaacactgaccaaggatcagcc
tgttcttacgaggaggagaaaggaggttgcaaattagtttcgtggttttctccaaatgaa
aagatcctcattgttattttcccaattttggctatactcctgttctggggaaagtttggt
attttaacactcaaatataaatccagccatacgaataagagaatcattctgctgctcgtt
gccgggctggtgctcacagtcatcgtggttgttggagccatccttctcatcccaggagaa
aagcccgtgaagaatgcttctggacttggcctcattgtaatctctacggggatattaata
ctacttcagtacaatgtgtttatgacagcttttggaatgacctctttcaccattgccata
ttgatcactcaagtgctgggctacgtccttgctttggtcgggctgtgtctctgcatcatg
gcatgtgagccagtgcacggcccccttttgatttcaggtttggggatcatagctctagca
gaactacttggattagtttatatgaagtttgtcgcttccaaccagaggactatccaacct
cctaggaataggtga

DBGET integrated database retrieval system