KEGG   Mus musculus (mouse): 16424
Entry
16424             CDS       T01002                                 

Symbol
Itih1, ITI-HC1, Intin1, Itih-1
Name
(RefSeq) inter-alpha trypsin inhibitor, heavy chain 1
  KO
K19014  inter-alpha-trypsin inhibitor heavy chain H1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16424 (Itih1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   16424 (Itih1)
SSDB
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 VWA_CoxE SH3_15
Other DBs
NCBI-GeneID: 16424
NCBI-ProteinID: NP_032432
MGI: 96618
Ensembl: ENSMUSG00000006529
Vega: OTTMUSG00000035524
UniProt: Q61702
Position
14; 14 B
AA seq 907 aa
MEGATGLRVLLCLLPLLTLQARPALGLATGRPRGSEKRHAVDTSVNGVSIKSLKVNCKVT
SRFAHYVITSQVVNNADKAREVAFDVEIPKTAFISDFAITSDGKAFIGDIKDKVTAWKQY
RKAAVLGESAGLVRASGRNMEQFTIHITVGAQSKATFRLTYEEVLKRRLMQYDITIKVRP
KQLVQHFEIDVDIFEPQGISKLDAQASFLSEELAAQTIKKSFSGKKGHVLFRPTVSQQQS
CPTCSTSLLNGEFKVTYDVNRDKLCDLLVANNYFTHFFAPKNLTNMSKNLVFVIDISGSM
EGQKVRQTKEALLKILEDMRPVDNFDLVLFGSKVQSWKGSLVPASNANLQAAQDFVRRFS
LAGATNLNGGLLRGIEILNKAQGSHPELSSPASILIMLTDGEPTEGETDRSQILKNVRNA
IRGRFPLYNLGFGHDLDFSFLEVMSTENNGWAQRIYEDHDATQQLQGFYNQVANPLLTDV
ELQYPQDAVLALTQHRHKQYYDGSEIVVAGRIANHKLNTFKADVRARGEKQEFRATCLVD
EEEMKKLLRERGHVLENHVERLWAYLTIQELLAKRMKTEGEERANLSSQVLKMSLDYHFV
TPLTSLTIRGLTDEDGLEPTIDKPLEDSQPLEMVGPRRTFVLSAIQPSPTAHPIDSKLPL
RVTGVDTDPHFIIYVPSKEDSLCFNINEEPGVILNLVQDPDTGFTVNGQLIGNKASSPGQ
HESTYFGRLGISSPTSDFQLEVTPQNITLNPSSSGSMFSWRDQAVLQKDGVVVTINKKRN
LVVSVDDGATFEIVLHRTWKGSAVHQDFLGFYVLDSFRMSARTKGLLGQFFSPLDFEVFD
LHPGSDPTKTDATMVVKNRQLTVTRGLQKDYSKDPRHGAEVPCWFVHDNGAGLIDGVHTD
YVVSDIF
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggagggtgccacagggctccgggtgctgctgtgcttgctgccgctcctcactctgcag
gccaggcctgctttgggcttggcaacaggcagacccaggggcagtgagaagcgacacgct
gtggacacttcagtcaatggtgtgtccatcaagagcttgaaagtcaattgcaaagtcacc
tctcgctttgcccactacgtcatcaccagccaagtggtcaacaatgctgataaagccagg
gaagtggcttttgatgtggaaatccccaagacagccttcatcagtgactttgccataaca
tcagatgggaaggcgttcattggggacataaaggacaaagtgactgcatggaagcagtac
cggaaggcagccgttttaggggagagcgctggccttgtcagagcctcgggcagaaatatg
gagcagttcaccatccatatcactgttggagcccagagcaaggccacgttccggctcacc
tatgaggaggtactaaagaggagactgatgcagtatgacatcaccatcaaagtcagaccc
aagcagctggtacagcattttgagatcgatgtggacatctttgaaccccaggggatcagc
aagctggacgctcaggcctccttcctcagtgaggaactggctgctcaaaccatcaagaag
tctttctcagggaaaaagggtcatgtgctcttccgccccactgtgagccagcagcagtcc
tgccccacatgttctacatccttgctaaatggagaattcaaggtgacctacgatgtcaat
cgagacaagctctgtgacctcctggtggccaacaactactttacacatttctttgccccc
aaaaacctgaccaacatgagcaagaacctggtttttgtgattgacatcagtggctccatg
gaaggccagaaagtgaggcagacaaaggaggcactccttaagatcctggaggacatgagg
ccagtagacaactttgacctggtcctctttggctctaaagtgcaatcatggaagggctcc
ctggtacctgcgtctaatgccaatctgcaagcagctcaagactttgtgaggcgcttttct
ttggctggagccacaaacctgaatggaggcttgctccgaggaatcgagatcttaaacaaa
gctcaaggaagccacccagaactcagcagcccggcctcaattcttatcatgttgacagac
ggagagcccactgaaggggagacggaccgttcccagatcctcaagaatgtacgcaacgct
atccggggcaggttcccgctctacaacctcggctttggccacgacctggacttcagcttc
ctggaggtcatgtccactgagaacaacggatgggcccagagaatttatgaggaccatgat
gccacccaacagctacagggtttctacaatcaagtagccaatcccctgctgacagatgtg
gaactgcagtacccccaggatgctgtcttggctctaacccagcaccgacataaacagtac
tatgacggctcggagattgtggtggctgggcgcattgctaaccacaaactgaacaccttt
aaggctgacgttcgggctcgtggggaaaagcaagaattcagggcaacctgcctagtggac
gaggaagagatgaagaaactgctccgagagcgtggccacgtgctagagaatcatgtggag
aggctctgggcctacctcacgatccaggagctcctggctaagcggatgaagacggaaggg
gaggagagggccaacctgtcatcccaggtcctgaagatgtcactggactatcatttcgta
acgccactgacctctctgactatcagaggcctgacagacgaggatgggctggagcccacc
attgacaagcccctggaggattctcagcccttagagatggtgggacccagaagaacgttt
gtgctgtcagccatacagccatctcctacagcccaccccatagactcaaagttgccactc
cgtgtgacaggtgtggacaccgatccccacttcatcatctatgtgccctcaaaagaggat
agcttgtgcttcaacatcaatgaggaacctggtgtgatcctgaacctagtacaggaccct
gacacaggcttcaccgtgaatgggcagctcattgggaacaaggccagcagccctgggcaa
cacgagagcacatacttcgggagattgggaatctcaagtcccacatcagactttcagctg
gaagtgactcctcagaacattacactgaaccccagctccagcgggtccatgttctcctgg
agggaccaggctgtgctgcagaaggatggggtagtggtgacaatcaacaagaagaggaac
ctggtggtgtctgtggatgatggggctacctttgagattgtcctgcacagaacatggaag
gggagtgcagtccaccaggacttcctgggtttctatgtgctggacagcttccggatgtca
gcccggacaaaggggctactgggacaattcttctccccactggattttgaagtatttgac
ctccacccaggctctgaccctacaaagacagatgccacaatggtggtgaagaatcggcag
ctgacagtcacccgagggttgcaaaaagactacagcaaggaccccagacatggagcagaa
gtgccttgctggtttgtccacgacaatggagctggactgattgatggtgttcacactgac
tatgtcgtctctgacatcttctga

DBGET integrated database retrieval system