KEGG   Mus musculus (mouse): 16425
Entry
16425             CDS       T01002                                 

Symbol
Itih2, AI747202, Intin2, Itih-2
Name
(RefSeq) inter-alpha trypsin inhibitor, heavy chain 2
  KO
K19015  inter-alpha-trypsin inhibitor heavy chain H2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16425 (Itih2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   16425 (Itih2)
SSDB
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 VWA_CoxE vWA-TerF-like SWIB GW DUF2201
Other DBs
NCBI-GeneID: 16425
NCBI-ProteinID: NP_034712
MGI: 96619
Ensembl: ENSMUSG00000037254
Vega: OTTMUSG00000011191
UniProt: Q61703 G3X977
Position
2 A1; 2 6.89 cM
AA seq 950 aa
MSSKMQRPVCLLIWLFLLEAQAFEIPINGNSEFAEYSDLVELAPDKLPFVQENGRHQRSL
PEESGEETDTVDPVTLYSYKVQSTITSRVATTTIQSKLVNNSPLPQSVVFDVQIPKGAFI
SNFTMTVNGMTFTSSIKEKTVGRALYSQARAKGKTAGWVRSRTLDMENFNTEVNIPPGAK
VQFELHYQEVKWRKLGSYEHKIHLQPGKLAKHLEVNVWIIEPQGMRFLHVPDTFEGHFQG
VPVISKGQQKAHVSFKPTVAQQRKCPNCTETAVNGELVVMYDVNREEKAGELEVFNGYFV
HFFAPENLDPIPKNILFVIDVSGSMWGIKMKQTVEAMKTILDDLRTDDQFSVVDFNHNVR
TWRNDLVSATKTQIADAKRYIEKIQPSGGTNINEALLRAIFILNEASNMGLLNPDSVSLI
ILVSDGDPTVGELKLSKIQKNVKQSIQDNISLFSLGIGFDVDYDFLKRLSNENRGIAQRI
YGNQDTSSQLKKFYNQVSTPLLRNVQFNYPQASVTDVTQNNFHNYFGGSEIVVAGKFDPS
KLTEVQSIITATSANTELVLETLSQMDDLEEFLSKDKHADPDFTKKLWAYLTINQLLAER
SLAPTAAIKRKITKTILQMSLDHHIVTPLTAMVIENDAGDERMLADSPPQDHSCCSGALY
YGTKVASGPIPSWANPSPTPMSAMLAVGAKPLESTPPTHLNQVENDPHFIIYLPKSKRNI
CFNIDSEPGKILSLVSDPESGIVVNGQLIGAKRAENGKLSTYFGKLGFYFQKEGMKIEIS
TETITLSSGSSTSRLSWSDTAHLGNSRVLISVKKEKSVTLTLNKELFFSVLLHRVWRKHP
VNVDFLGIYAPPIDKFSPRVHGLLGQFMQEPAIHIFNERPGKEPGKPEASMEVKGHKLTV
TRGLQKDYRTDIVFGTDVPCWFVHNSGKGFIDGHYKDYFVPQLYSFLKRP
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgtccagcaaaatgcagcggcctgtgtgccttctcatctggctgtttcttctggaagca
caagccttcgaaatccccataaacggaaactcagaatttgcagaatacagtgatcttgtg
gaactggccccagataaactcccatttgtgcaagagaatggaagacatcagagaagcctt
cctgaggaatccggagaggagacggacactgttgatccagtgactctttatagctacaaa
gtccagtccactattacttctcgggtggccacaactaccatccagagcaaactggtgaac
aattccccattgcctcagagtgtcgtgttcgatgttcagattcccaaaggagcctttatc
tccaacttcaccatgactgtgaacggcatgacatttacaagctccattaaagagaaaact
gtgggccgagctctttattcacaggcaagagcaaagggcaagacggctggatgggtaagg
agcagaactctggatatggagaacttcaacacagaggtgaacatcccgcctggagccaag
gtgcagtttgaacttcattaccaggaggtgaagtggaggaagctgggatcctatgagcac
aagattcatttgcagcccgggaagctggccaaacacttggaggtgaatgtgtggattatc
gaaccccaaggaatgagatttcttcatgttcctgacacatttgaaggccatttccaaggc
gtccctgtcatatctaaaggacaacagaaggcacatgtatccttcaagcccacagtagca
caacaaagaaaatgccccaactgcacagagactgcagtgaacggggagctggtggtgatg
tatgatgtcaacagagaagagaaggccggggaacttgaggtgtttaatggatattttgtt
cacttctttgctcctgagaacctggacccaatccccaagaacatcctttttgttattgac
gtcagtggctccatgtgggggattaagatgaagcagactgtggaggcaatgaagacgata
ttggatgacctaagaacagacgaccaattctctgtggttgatttcaaccataatgttcga
acctggagaaatgatttagtttcagctactaaaacacaaattgcagatgccaagagatac
attgagaaaattcagcctagtggaggcacgaatatcaacgaggcactgcttcgagcaatt
ttcattttgaatgaagccagtaacatgggattgctgaaccccgactcagtctctctgatc
attttggtttctgatggagatccaaccgtaggggaactaaaattgtccaaaattcagaaa
aatgtgaagcagagcatccaagataacatctccctgtttagtttgggaatcggatttgat
gtcgactatgattttttgaagaggctgtccaatgaaaatcgtggtattgctcaacggatc
tacgggaaccaggacacatcctctcagctcaagaaattttacaaccaggtctctactcca
ctgctcagaaatgttcagtttaactacccgcaggcatcagtaacagatgtcacccaaaac
aatttccacaactacttcggaggttctgagatcgtggtggcagggaaatttgatcccagc
aaactgacagaagtccagagcatcatcacggcaacttcggctaacacagaattggtcttg
gaaaccctgagccagatggatgacttggaggagtttctgtcaaaggacaagcatgcagac
cctgacttcaccaagaagctgtgggcctatctcaccatcaaccaactactagcagagaga
agtctggctcctactgctgccatcaaaaggaaaatcaccaaaacaatcctgcagatgtct
ctagaccatcacatcgtgactccgcttactgccatggtgatagagaatgatgctggagat
gaacgcatgctggctgactccccgccacaggaccactcctgctgctcaggcgcactgtat
tatggcaccaaggttgcctcgggtcccatcccatcatgggccaacccatctccgacacca
atgtcggccatgcttgcagtcggagcgaagccacttgagtctactccacctactcatttg
aatcaagtggaaaatgacccccacttcatcatttacctgcccaaaagcaaaaggaatatt
tgtttcaatattgactcagaacctgggaaaatcctaagcctggtgtctgacccagaatca
gggattgtagtcaacggtcagcttatcggcgccaagagggcagagaatggaaagctaagc
acctactttggaaaactggggttttatttccaaaaggaaggcatgaagatagaaatcagc
accgagaccatcaccctgagctctggctcctctacatctcgactgtcctggtccgacaca
gctcatcttggaaactcgagggtgctcatctctgtgaagaaagaaaaatctgtgactctc
accctgaataaagagctgttcttttccgttctgctgcatcgtgtgtggaggaagcaccca
gttaacgtggacttcctggggatctacgctccccccatagacaagttctcacctagagtg
catggactgttaggccagttcatgcaggagccagccatccacatcttcaatgagagaccc
ggaaaggagccgggaaaacccgaggcaagcatggaggtgaaaggacataagctgactgtc
accagaggcctgcagaaggactacaggacggatatcgtgtttggaacagacgttccctgc
tggtttgtacacaacagtgggaaaggtttcatcgatggacattataaggattattttgtg
cctcagctctacagctttctcaagcggccttaa

DBGET integrated database retrieval system