KEGG   Mus musculus (house mouse): 16426
Entry
16426             CDS       T01002                                 
Symbol
Itih3, ITI-HC3, Intin3, Itih-3
Name
(RefSeq) inter-alpha trypsin inhibitor, heavy chain 3
  KO
K24513  inter-alpha-trypsin inhibitor heavy chain H3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    16426 (Itih3)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   16426 (Itih3)
SSDB
Motif
Pfam: ITI_HC_C VIT VWA VWA_3 VWA_2 vWA-TerF-like VWA_CoxE AA9
Other DBs
NCBI-GeneID: 16426
NCBI-ProteinID: NP_032433
MGI: 96620
Ensembl: ENSMUSG00000006522
UniProt: Q61704
Position
14:complement(30630529..30645748)
AA seq 889 aa
MRTMWWPCLVLALLSGLETSGFPRSPLQLLGKRSLPEGVVDGIEVYSTKISCKVTSRFAH
NVVTTRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAQKQYEKAVS
QGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRNKGKYEMYLKVQPKQLVR
HFEIDAHIFEPQGISMLDAEASFITNDLLGSALTKSFSGKKGHVSFKPSLDQQRSCPTCT
DSLLNGDFTIVYDVNRESPGNVQIVNGYFVHFFAPQGLPVVPKNIVFVIDVSGSMSGRKI
QQTREALLKILDDVKEDDYLNFILFSTDVTTWKDHLVQATPANLKEAKTFVKNIHDQSMT
NINDGLLKGIEMLNKAREDHTVPERSTSIIIMLTDGDANTGESRPEKIQENVRNAIGGKF
PLYNLGFGNNLNYNFLETLALENHGLARRIYEDSDANLQLQGFYEEVANPLLTNVEVEYP
ENAILDLTRNSYPHFYDGSEIVVAGRLVDRNMDNFKADVKGHGALNDLTFTEEVDMEEMD
AALKEQGYIFGDYIERLWAYLTIEQLLEKRKNAKGDEKENITAEALDLSLKYHFVTPLTS
MVVTKPEDNEDQTSIADKPGEEAIAETTTMSFLTTQQSSQSPYYYVDGDPHFIIQIPGKN
DSICFNIDEKPGTVLRLIQDPVTGITVTGQIIGDKRSNASSRTGKTYFGKLGITNAWMDF
RVEVTTEKIILGTGAELSTFSWLDTITVTQTGLSVTINRKKNMVVSFGDGISFVIILHQV
WKKHPVHQDFLGFYVVDSHRMSAQTHGLLGQFFQPFDFKVFGIRPGSDPTKPDATMVVKN
HRLTVTRGSQKDYRKDASVGTKVICWFVHNNGEGLIDGVHTDYIVPSLF
NT seq 2670 nt   +upstreamnt  +downstreamnt
atgaggactatgtggtggccctgccttgtcttggctctgctctctggcttggagacctct
ggctttccgagaagtcccctccagctgcttgggaaacggagcctcccagagggggtggtg
gatggcattgaggtttacagcaccaagatcagctgcaaggtgacctcccgctttgctcac
aatgttgtcaccacaagggctgtcaaccgtgcagacacagccaaggaggtgtcctttgat
gtggaactgcccaagacagccttcatcaccaacttcaccttgaccattgatggtgtcacc
taccccgggaacgtcaaggagaaggaagttgcccagaaacaatatgaaaaggctgtgtcc
cagggcaagacagccggtttggtcaaggcctctgggaggaaactggagaaattcacagtg
tctgtcaacgtggctgcaggcagcaaagtcacctttgagctaacctatgaagaactgctc
aagagaaacaagggcaagtacgagatgtaccttaaggtccagcccaaacaactggtcaga
cactttgagattgatgcacacatcttcgagccacagggcattagcatgctagatgctgaa
gcctcattcatcactaatgacctcctgggaagcgccctcaccaagtccttctcaggcaag
aaggggcacgtgtctttcaagcccagcttagaccagcagcgttcatgcccgacctgtaca
gactccctcctcaacggggacttcaccattgtctacgatgtgaacagagagtctccaggg
aatgtgcagatagtcaatggctactttgtgcacttctttgcaccccaaggccttccagtg
gtgcctaagaacatagtctttgtgattgatgtcagcggctccatgtctggtcggaaaatc
cagcagaccagggaagcccttcttaaaatcctggatgacgtgaaagaagatgactacctg
aatttcattctcttcagcaccgatgtgaccacctggaaagatcacctagttcaagccacc
cctgcaaacctcaaggaggccaagacatttgtgaagaacatccatgatcaaagcatgacc
aacatcaatgatgggctgctgaagggtattgaaatgctgaacaaggcccgagaggaccac
actgtcccagagaggagcacctccatcatcatcatgttgacagacggggatgccaatact
ggcgagagcagaccagaaaagatccaggaaaacgtccggaatgccatcgggggcaagttc
cctttgtataacctgggttttggcaacaatctgaattataatttcctggagactctggcc
ctggagaaccatgggcttgcccggcgcatttatgaagattctgatgccaacttgcagctg
cagggcttctatgaagaggtagctaatccactgctgactaatgtggaggtggaatacccc
gagaacgccatcctagacctcaccaggaacagttacccccacttctacgatggctctgag
attgttgtagcagggcgcctggtggacaggaacatggacaacttcaaagcagatgtgaag
ggccatggggccttgaatgacctgaccttcacagaggaggtagacatggaggaaatggat
gcagccctgaaggagcaaggctacatttttggggactacattgagcgactctgggcctac
ctcactattgagcagctactggagaaacgcaagaatgccaaaggggatgagaaggagaac
atcacagcggaggccctggatctgtccctcaagtaccactttgtaaccccactgacctcc
atggtggtgaccaagcctgaggacaatgaagaccagacatccattgctgacaagcctggg
gaagaagccatcgctgagaccacgaccatgtccttcttgaccactcagcagtccagtcag
agcccctactattatgtggatggggacccccactttatcatccaaatcccgggaaaaaac
gacagcatctgcttcaacatcgacgagaagcctggaaccgtgctgcgcctgattcaggac
ccagtcacaggtatcactgtgaccggacagatcatcggagataagcgaagtaacgcttct
tccaggacagggaaaacttattttggcaaactgggcattaccaatgcttggatggacttc
cgggttgaggtgaccacggagaaaatcatcctagggactggggccgagctgagcacgttc
agttggctagacacaatcacggtcacacagactgggctgtctgtaacaatcaacaggaaa
aagaatatggtggtgtcctttggagatgggattagctttgtgatcatcctacaccaggtt
tggaagaaacatccagttcaccaggacttcctagggttctacgtggtggacagtcaccgg
atgtcagcacagacacatgggctgctgggccagttcttccaaccctttgactttaaagtg
tttggcatccgcccaggctctgaccctacaaagccagatgccacaatggtggtgaagaat
catcggttgactgtcacaaggggctcccagaaagattacaggaaggatgccagtgttggc
accaaggtcatctgctggtttgtccataacaatggagaaggactaattgatggtgtccat
accgactatattgttcccagcttgttctga

DBGET integrated database retrieval system