KEGG   Mus musculus (mouse): 16432Help
Entry
16432             CDS       T01002                                 

Gene name
Itm2b, AI256040, Bri, Bri2, Bricd2b, D14Sel6, E25BMM, imBRI2
Definition
(RefSeq) integral membrane protein 2B
  KO
K18264  integral membrane protein 2B
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16432 (Itm2b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16432 (Itm2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BRICHOS
Motif
Other DBs
NCBI-GeneID: 16432
NCBI-ProteinID: NP_032436
MGI: 1309517
Ensembl: ENSMUSG00000022108
UniProt: O89051
Position
14 D3; 14 38.88 cM
AA seq 266 aa AA seqDB search
MVKVTFNSALAQKEAKKDEPKSSEEALIVPPDAVAVDCKDPGDVVPVGQRRAWCWCMCFG
LAFMLAGVILGGAYLYKYFALQPDDVYYCGLKYIKDDVILNEPSADAPAARYQTIEENIK
IFEEDAVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPKNL
LELLINIKAGTYLPQSYLIHEHMVITDRIENVDNLGFFIYRLCHDKETYKLQRRETIRGI
QKREASNCFTIRHFENKFAVETLICS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtgacgttcaactcggcgctggcccagaaggaggccaagaaggacgagccc
aagagcagcgaggaggcgctcatcgtccctccggatgccgtggcggtggattgcaaggac
ccgggtgacgtggttccggttggacagaggagagcgtggtgttggtgcatgtgtttcgga
ctggccttcatgcttgctggcgtcatcctcggaggggcgtacctgtacaagtattttgct
cttcagccagatgatgtgtactactgtggactaaagtacatcaaagatgacgtcatcctg
aacgagccttctgcggatgccccagctgctcgctaccagacaattgaagagaacattaag
atctttgaggaagacgcagtggaattcatcagtgtgcctgtaccagagtttgcggacagc
gatcctgccaacattgtgcacgacttcaacaagaaactcactgcttatttggaccttaac
ctggacaagtgctacgtgattcctctgaacacttccatcgttatgccgcccaaaaacctg
ctggagctccttattaacattaaggccgggacctacctgcctcagtcctaccttatccat
gagcacatggtgatcaccgaccgcatcgagaacgtggacaacctgggcttcttcatctac
cgactgtgtcacgacaaggagacctacaaactgcagcgccgggaaacaattagaggtatt
cagaagcgggaagccagtaactgtttcaccattcggcattttgagaacaaatttgctgtg
gagactttaatttgttcttga

DBGET integrated database retrieval system