KEGG   Mus musculus (mouse): 16440Help
Entry
16440             CDS       T01002                                 

Gene name
Itpr3, IP3R_3, Ip3r3, Itpr-3, tf
Definition
(RefSeq) inositol 1,4,5-triphosphate receptor 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04114  Oocyte meiosis
mmu04210  Apoptosis
mmu04218  Cellular senescence
mmu04270  Vascular smooth muscle contraction
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04742  Taste transduction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04918  Thyroid hormone synthesis
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    16440 (Itpr3)
   04020 Calcium signaling pathway
    16440 (Itpr3)
   04070 Phosphatidylinositol signaling system
    16440 (Itpr3)
   04022 cGMP-PKG signaling pathway
    16440 (Itpr3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    16440 (Itpr3)
   04210 Apoptosis
    16440 (Itpr3)
   04218 Cellular senescence
    16440 (Itpr3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    16440 (Itpr3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    16440 (Itpr3)
   04621 NOD-like receptor signaling pathway
    16440 (Itpr3)
   04625 C-type lectin receptor signaling pathway
    16440 (Itpr3)
  09152 Endocrine system
   04911 Insulin secretion
    16440 (Itpr3)
   04922 Glucagon signaling pathway
    16440 (Itpr3)
   04912 GnRH signaling pathway
    16440 (Itpr3)
   04915 Estrogen signaling pathway
    16440 (Itpr3)
   04921 Oxytocin signaling pathway
    16440 (Itpr3)
   04918 Thyroid hormone synthesis
    16440 (Itpr3)
   04928 Parathyroid hormone synthesis, secretion and action
    16440 (Itpr3)
   04924 Renin secretion
    16440 (Itpr3)
   04925 Aldosterone synthesis and secretion
    16440 (Itpr3)
   04927 Cortisol synthesis and secretion
    16440 (Itpr3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    16440 (Itpr3)
  09154 Digestive system
   04970 Salivary secretion
    16440 (Itpr3)
   04971 Gastric acid secretion
    16440 (Itpr3)
   04972 Pancreatic secretion
    16440 (Itpr3)
  09156 Nervous system
   04724 Glutamatergic synapse
    16440 (Itpr3)
   04725 Cholinergic synapse
    16440 (Itpr3)
   04728 Dopaminergic synapse
    16440 (Itpr3)
   04726 Serotonergic synapse
    16440 (Itpr3)
   04720 Long-term potentiation
    16440 (Itpr3)
   04730 Long-term depression
    16440 (Itpr3)
   04723 Retrograde endocannabinoid signaling
    16440 (Itpr3)
  09157 Sensory system
   04742 Taste transduction
    16440 (Itpr3)
   04750 Inflammatory mediator regulation of TRP channels
    16440 (Itpr3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    16440 (Itpr3)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    16440 (Itpr3)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    16440 (Itpr3)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    16440 (Itpr3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    16440 (Itpr3)
   05163 Human cytomegalovirus infection
    16440 (Itpr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16440 (Itpr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    16440 (Itpr3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16440 (Itpr3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16440 (Itpr3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  IP3 receptor
   16440 (Itpr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 16440
NCBI-ProteinID: NP_542120
MGI: 96624
Ensembl: ENSMUSG00000042644
Vega: OTTMUSG00000031360
UniProt: P70227
Structure
PDB: 

Position
17 A3.3; 17 13.68 cM
AA seq 2670 aa AA seqDB search
MNEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDVSDPKAAGLGAQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNAPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQYMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNRIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDRNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISKQLGVELLFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANDEKNILTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCIQAPAA
MLQAYEEPGGKNVRRSIQGVGHMMSTMVLSRKQSVFGASSLPAGVGVPEQLDRSKFEDNE
HTVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSST
ATMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLLHLTMHDYPSLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSVKGEEVE
AGATKDKKERPSDEEGFLQPHGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKSDNKMLEILRYTHQFLQKFCAGNPGNQALLHKHLQLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVTVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMALVCNKREKRLSDPTLEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACVRTLAMVAKSRAILLPMDLDAHMSALLSSGGSCSA
AAQRSAANYKTATRTFPRVIPTANQWDYKNIIEKLQDIIMALEERLKPLVQAELSVLVDM
LHWPELLFPEGSEAYQRCESGGFLSKLIRHTKGLMESEEKLCVKVLRTLQQMLLKKSKFG
DRGNQLRKMLLQNYLQNRKSGARGELTDPTGSGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMSDLGSQPREDREPADPATKGRVSSFSMPSSSRYLLGLGLHRGHDMSERAQNN
EMGTSVLIMRPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGG
LGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPL
CKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEEREN
SEVSPREVGHNIYILALQLSRHNKQLQHLLKPVRRIQEEEAEGISSMLSLNNKQLSQMLK
SSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPAICQFLTEETKHRLFTTTEQ
DEQGSKVSDFFDQSSFLHNEMEWQRRLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAF
FYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPT
LNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFY
SILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDR
LPGNHSRASPLGMPHGAATFMGTCSGDKMDCVSEVSVPEILEEDEEPDSTERACDTLLMC
IVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFA
DLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNKT
DYTGPESYVAQMIKNKNLDWFPRMRAMSLVSGEGEGEQNEIRILQEKLGSTMKLVSHLTS
QLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8013 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaatgtccagctttcttcacatcggggacattgtgtccctgtacgccgagggc
tctgtcaatggcttcatcagcactttggggctggtggatgaccgttgtgtggtggaacct
gcagctggggacctggacaacccccccaagaagttccgagattgcctcttcaaagtgtgc
cccatgaaccgctactctgcacagaaacagtactggaaagccaagcagactaaacaggac
aaagagaagattgctgatgtggtattgctgcagaagctgcagcacgcagcccagatggag
cagaagcaaaatgacacagagaacaagaaggtgcacggggacgtggtgaagtacggcagc
gtgattcagcttctgcatatgaagagcaacaaatacttaactgtgaacaagcggctgcca
gccctgctggagaagaatgccatgcgggtgacgctggatgctacgggcaatgagggctcc
tggctcttcatccagcccttctggaagcttcggagcaatggggataatgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcccttacatgccagcaactatgag
cttagtgataatgctggctgcaaagaggtcaactctgtcaactgcaacaccagctggaag
atcaacttattcatgcagttccgggaccacctggaggaggtgctgaaggggggagacgtg
gtgcgactgttccacgcggagcaggagaagttcctgacctgtgatgagtacaggggcaag
ctgcaggtgttcctgcggaccacgctccgccagtccgccacctcggccaccagctccaac
gcactctgggaggtggaggtggtccaccacgacccctgccgcgggggagccggacactgg
aacggtctgtacaggttcaagcacctggccacgggcaactatctggccgctgaggaaaac
cccagctacaagggtgatgtctcagatcctaaggcagctggactgggggcccagggccgc
actggccgcaggaacgcaggcgagaagatcaagtaccgtctggtggctgtgccacatggg
aatgacatcgcgtctctcttcgagctggaccccaccacgctgcagaaaaccgactccttc
gtgccccggaactcctacgtgcggctgcggcacctctgcaccaacacctggatccagagt
accaacgcgcccatcgacgtggaggaggaacggcctatccggctcatgttgggcacatgc
cccaccaaggaggacaaagaggcctttgccattgtgtcggttcctgtgtcggagatccgc
gacctggactttgccaacgacgccagctccatgctggccagcgccgtggagaaactcaac
gaaggcttcatcagccagaacgaccgcaggtttgtcatccagctgttggaggacttggtg
ttttttgtcagcgatgttcccaacaatgggcagaatgtcctggacatcatggtcaccaag
cccaaccgggagcggcagaagctgatgcgggagcagaacatacttaagcagatctttggc
atcctgaaggctccattccgtgacaaggggggtgaaggaccactagtgcggctggaggaa
ctgtctgaccagaagaacgccccctaccagtacatgttccgtctctgctaccgggtgttg
cggcattctcaggaggactaccgcaagaatcaggagcacatagccaagcagtttgggatg
atgcagtcacagattggctatgacatcctggctgaagacaccatcactgccctgctgcac
aacaaccggaagcttctagagaaacacatcaccaagacggaggtggagacctttgtcagt
ctcgtgcgcaagaacagggagcccagattcctggactacctctccgacctgtgcgtgtcc
aaccgtatcgccatccctgtcacccaagagctgatttgcaaatgtgtgctggaccctaag
aacagtgacattcttatccagactgagctgcggccagtgaaggagatggctcagtctcac
gagtacctcagcatcgagtactcagaggaggaggtgtggctcacatggacggacaggaac
aatgagcaccacgagaagagcgtgaggcagctggcccaggaggcgagggctggcaacgca
cacgatgagaacgtgctcagctactacaggtaccagttgaagctgtttgcccgcatgtgc
ctggaccgccagtacttggccattgatgagatctccaagcagctgggtgtcgagctgctt
ttcctgtgcatggctgacgagatgctgccctttgacctccgcgcctcattctgccatctg
atgctacatgtgcacgtggaccgcgaccctcaggagctggtgacccctgtcaagtttgcc
cgcctctggacagagatccccacggccatcaccattaaagactatgattccaatctcaac
gcgtcgagagatgacaaaaaaaacaagtttgccagcaccatggagttcgtagaagattac
ctcaacaacgtggtcagcgaggccgtgccctttgccaacgacgagaagaacatactcacc
tttgaggtggtgagcctggcgcacaatctcatctacttcgggttctacagcttcagcgag
ctgctgaggctcacacgcacgctactgggcatcatagactgcatccaggcaccggcagcc
atgctgcaggcctatgaggagcctggtggcaagaatgtgcggaggtccatccagggggtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtctgtatttggtgcctccagc
ctgcctgctggagtgggtgtccctgagcagctagacagaagcaaatttgaggacaatgag
cacactgtggtgatggagaccaaactgaagatcctggagattctgcagttcatcctgaac
gtacgcttagactaccgcatctcctacctgttgtcggtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggcggacggcacggcacctgcctttgattcctccact
gccaccatgaatctggaccgcatcggagagcaggcagaggccatgtttggagtagggaag
accagcagcatgctggaggtggacgatgaaggtggccgcatgttcctgcgagtgctgctg
cacctgaccatgcacgactacccgtctcttgtctccggtgcgctgcagctgctcttcaaa
cacttcagccagcgccaggaagccatgcacactttcaagcaggtccagttgctgatctca
gcccaggatgtggagaactacaaggtgatcaagtcagagctggaccgactgcggacgatg
gtggagaagtcagagctgtgggtggacaagaaaggcagcgtcaagggcgaggaggttgag
gcaggcgccaccaaggataagaaggagagaccctcggacgaggagggatttctgcagcca
cacggggagaagagcagcgagaactaccagattgtgaaaggcatcctggagaggctgaac
aagatgtgtggggtgggggagcagatgaggaagaagcaacaaaggttgctgaagaacatg
gacgcccacaaggtcatgctggacctactgcagatcccttacgacaagagcgacaacaag
atgctggagatactgcgctacacacaccagttcctacagaagttctgtgctgggaaccct
ggcaaccaggcccttctgcacaaacacttgcagctcttcctcacgcctgggctcctggag
gctgagaccatgcagcacattttcctcaacaactaccagctgtgctctgagatcagcgag
ccggtgttgcaacactttgtgcacctgctggccacacacgggcgccatgtgcagtacttg
gacttcctgcacactgtcatcaaggctgagggcaagtacgtgaagaagtgccaggacatg
attatgaccgagctgaccaatgcaggtgacgacgtggtggtgttctacaacgacaaggcc
tctctggctcatctgttggacatgatgaaggcagccagagatggcgtggaggaccacagc
cctctcatgtatcacatctccctggtggacctgctggctgcctgtgcagagggcaagaac
gtctacacagagatcaagtgcacctccctcttgcctctagaggacgtggtgactgtggtc
acccacgaggattgtatcacggaggttaaaatggcttatgtgaacttcgtgaatcactgc
tacgtagacacggaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
ttcgagaacttcaccctggacatggctctggtctgtaacaagcgggagaagcgcctgtca
gaccccacccttgagaagtacgtgctcaccgtggtcctggacaccatcagtgccttcttc
agctccccgttttcagagaacagcacatccctacagacgcaccagacaattgtggtccag
ctgctgcagtccaccacgcggctgctcgagtgtccttggctgcagcagcagcataagggc
tccgtggaggcctgtgtccgcaccctcgccatggtggccaagagtagagccatcttgctg
ccaatggatctggatgcccacatgagcgccctgctcagcagtgggggcagctgttccgcc
gctgcccagcgcagcgctgccaactacaagacggccaccaggaccttccctcgggtcatc
cccactgccaaccagtgggactacaagaacatcattgagaagttacaggatatcatcatg
gccctagaagagcggctgaagcctctggtacaggctgagctctctgtccttgtggacatg
ctgcactggcctgagctgctttttccagagggcagtgaggcctaccagcgctgcgagagc
gggggcttcctgtctaagctcatccgtcacactaagggtctcatggagtccgaggagaag
ttgtgcgtgaaggtgctgcggacgctgcagcagatgctgctgaagaagagcaagttcggg
gaccggggcaaccagctgcggaaaatgctgctgcagaattatctccagaaccgcaagtct
ggcgcccggggcgagctcactgaccccacgggctctggcctggatcaggactggtcagcc
atcgccgccacccagtgccggctggacaaggagggggccaccaagctggtgtgtgatctt
atcaccagcaccaagaacgagaagatcttccaggagagcattggcctggccatccgcctg
ctggacgggggcaacaccgagatccagaagtctttctacaacctgatgacaagtgacaag
aagtcggagcgcttcttcaaggtgcttcatgaccgcatgaagcgcgcccagcaggagacc
aagtccacggtcgctgtcaacatgagcgacctgggcagccagcctcgtgaggaccgggag
ccggcagatcctgccaccaaaggccgcgtgtcctccttctccatgcccagctcctcccgc
tatttgctgggcctcggcttgcaccgagggcacgacatgagcgagcgggcgcagaacaac
gagatggggacctcggtgctgatcatgcggcccatcctgcgcttcctgcagctgctgtgt
gagaaccacaaccgtgacctgcaaaacttcctgcgctgtcagaacaacaagaccaactac
aacctggtgtgtgagaccctgcagttcctggacatcatgtgtggcagcaccacagggggc
ctggggctgctggggctctacatcaacgaggacaacgtgggcctggtcatccagaccttg
gagaccctcacagagtactgccagggcccatgtcatgagaaccagacctgcattgtgact
cacgaatccaacggcatcgacatcatcacggcgctgatcctcaatgacatcagcccgctt
tgcaagtaccgcatggacctggtgctgcagctcaaggacaatgcctccaagctgctcctg
gctctgatggagagccgacatgacagtgagaatgcagagcgcatcctcatcagccttcgg
cctcaggagctggtggacgtgatcaagaaggcctacctgcaggaggaggagagggagaat
tcagaagtgagcccacgtgaagtgggccacaacatctacatcctagcactgcagctttcc
aggcacaacaagcagctgcagcacctgctgaagccagtgaggcgcatccaggaggaggag
gccgagggcatctcttccatgctcagcctcaacaataagcagctgtcccagatgctcaag
tcctcggcccccgcccaggaggaggaagaggacccgctggcctactatgagaatcacacc
tcgcagattgagattgtgcggcaagaccgaagcatggagcagatcgtgttcccggtacct
gccatctgccagttcctgacagaggagacgaagcaccggctcttcaccaccactgagcag
gacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaacgag
atggagtggcagcgccggcttcgcagcatgccgctcatctactggttctcccgccgcatg
acgctgtggggcagcatctccttcaacctggctgtgttcatcaatatcatcattgccttc
ttctacccctatgtggagggcgcttccacaggcgtgctgggctcgccgctcatctcgcta
ctcttctggatcctcatctgcttctccatcgctgcactgttcaccaagcgctacagcgtc
cgtcccctcatcgtggcgctgatccttcggtccatctactacctgggcattgggcccacg
ctcaacatcctgggtgctctcaatctgaccaacaagatcgtgtttgtggtgagcttcgtg
ggcaaccgtggcaccttcatccgaggctataaggccatggtcatggacatggagttcctg
taccatgtgggctacatcctgacaagcgtcctgggcctctttgcccatgagctcttctac
agcatcctgctctttgacctcatctaccgagaggagacgctgtttaatgtcatcaagagt
gtgacccgcaatggccgctccatcctactgaccgccctgctggccctcatccttgtgtac
ctcttctccatcgtgggcttcctcttcctcaaggacgacttcatcctggaggtggaccgg
ctgcccgggaaccactccagagccagccccctggggatgccacacggagctgccacattt
atgggcacatgtagtggggacaagatggactgtgtctctgaggtctcagtgcctgagatc
ctagaagaggacgaggagcccgatagcacggagcgggcctgtgacactctacttatgtgt
atcgtgaccgtcatgaaccacggactgaggaacggtggtggcgtgggcgacatcctccgc
aagccctccaaagatgagtcgctcttcccagccagagtggtgtatgaccttctgttcttc
tttatcgtcatcatcatcgtgttgaacctcatctttggggtgatcatcgacacctttgcc
gatctgcgcagcgagaagcagaagaaagaggaaatccttaagaccacgtgcttcatctgt
ggtctggagagggacaagtttgacaacaagacagtgtccttcgaggagcacatcaaactg
gagcataacatgtggaactacctgtacttcattgtactggtccgagtcaagaacaagaca
gactacaccggccccgagagctatgtggctcagatgatcaagaacaagaacctggactgg
ttcccgcggatgcgtgccatgtccctggtgagcggcgagggggagggggagcagaatgag
atccgcatcctgcaggagaagctcggctccaccatgaagctggtgtcgcacctcacctcc
cagctcaatgaactcaaggagcagatgacggagcagcggaaacggaggcagcgtctgggc
tttgtggatgtgcagaactgcatgagccgctga

DBGET integrated database retrieval system