KEGG   Mus musculus (mouse): 16449
Entry
16449             CDS       T01002                                 

Gene name
Jag1, ABE, ABE2, Gena228, Gsfab, Gsfabe2, Headtu, Htu, Oz, Ozz, Ser-1, Serra
Definition
(RefSeq) jagged 1
  KO
K06052  jagged-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04371  Apelin signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04668  TNF signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05207  Chemical carcinogenesis - receptor activation
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    16449 (Jag1)
   04371 Apelin signaling pathway
    16449 (Jag1)
   04668 TNF signaling pathway
    16449 (Jag1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16449 (Jag1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16449 (Jag1)
   05207 Chemical carcinogenesis - receptor activation
    16449 (Jag1)
  09162 Cancer: specific types
   05224 Breast cancer
    16449 (Jag1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16449 (Jag1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    16449 (Jag1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16449 (Jag1)
CD molecules [BR:mmu04090]
 Proteins
  16449 (Jag1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3
Other DBs
NCBI-GeneID: 16449
NCBI-ProteinID: NP_038850
MGI: 1095416
Ensembl: ENSMUSG00000027276
Vega: OTTMUSG00000015560
UniProt: Q9QXX0 Q3UVN4
Position
2 F3; 2
AA seq 1218 aa
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGVRN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTIQPDSIIEKASHSGMINPSRQWQTLKQNTGIAHFE
YQIRVTCDDHYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPDCNKAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNRGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSSGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNARSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTTCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAHCENNINDCSQNPCHYGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEVDTFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYQCICPPGHSGAKCHEVSGRSCITMGRVILDGAKWDDDCNTCQCLNGRVACSKVWCGPR
PCRLHKSHNECPSGQSCIPVLDDQCFVRPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSLSANNEIHVAISAED
IRDDGNPVKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WVCCLVTAFYWCVRKRRKPSSHTHSAPEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKVRFAKQPVYTLVDREEKAPSGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcggtccccacggacgcgcggccggcccgggcgccccctgagtcttctgctcgccctg
ctctgtgccctgcgagccaaggtgtgcggggcctcgggtcagtttgagctggagatcctg
tccatgcagaacgtgaatggagagctacagaatgggaactgttgtggtggagtccggaac
cctggcgaccgcaagtgcacccgcgacgagtgtgatacgtacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcactgccgggggaccctgcagcttcggctcagggtctacgcct
gtcatcgggggtaacaccttcaatctcaaggccagccgtggcaacgaccgtaatcgcatc
gtactgcctttcagtttcgcctggccgaggtcctacactttgctggtggaggcctgggat
tccagtaatgacactattcaacctgatagcataattgaaaaggcttctcactcaggcatg
ataaaccctagccggcaatggcagacactgaaacaaaacacagggattgcccacttcgag
tatcagatccgagtgacctgtgatgaccactactatggctttggctgcaataagttctgt
cgtcccagagatgacttctttggacattatgcctgtgaccagaacggcaacaaaacttgc
atggaaggctggatgggtcctgattgcaacaaagctatctgccgacagggctgcagtccc
aagcatgggtcttgtaaacttccaggtgactgcaggtgccagtacggttggcagggcctg
tactgcgacaagtgcatcccgcacccaggatgtgtccacggcacctgcaatgaaccctgg
cagtgcctctgtgagaccaactggggtggacagctctgtgacaaagatctgaattactgt
gggactcatcagccctgtctcaaccggggaacatgtagcaacactgggcctgacaaatac
cagtgctcctgcccagagggctactcgggccccaactgtgaaattgctgagcatgcttgt
ctctctgacccctgccataaccgaggcagctgcaaggagacctcctcaggctttgagtgt
gagtgttctccaggctggactggccccacgtgttccacaaacatcgatgactgttctcca
aataactgttcccatgggggcacctgccaggatctggtgaatggattcaagtgtgtgtgc
ccgccccagtggactggcaagacttgtcagttagatgcaaatgagtgcgaggccaaacct
tgtgtaaatgccagatcctgtaagaatctgattgccagctactactgtgattgccttcct
ggctggatgggtcagaactgtgacataaatatcaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgagtgtgctagcaacccctgcttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctctgtcccactggtttctctggaaac
ctctgtcagctggacatcgattactgcgagcccaacccttgccagaatggcgcccagtgc
tacaatcgtgccagtgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgtaccaccacctgcgaagtgattgacagctgcactgtg
gccatggcctccaacgacacgcctgaaggggtgcggtatatctcttctaacgtctgtggt
ccccatgggaagtgcaagagccagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcaccggcacctactgccatgaaaatatcaacgactgcgagagcaacccctgtaaaaac
ggtggcacctgcatcgatggcgttaactcctacaagtgtatctgtagtgacggctgggag
ggagcgcactgtgagaacaacataaatgactgtagccagaacccttgtcactacgggggt
acatgtcgagacctggtcaatgacttttactgtgactgcaaaaatggctggaaaggaaag
acttgccattcccgtgacagccagtgtgacgaagccacgtgtaataatggtggtacctgc
tatgatgaagtggacacgtttaagtgcatgtgtcccggtggctgggaaggaacaacctgt
aatatagctagaaacagtagctgcctgccgaacccctgtcataatggaggtacctgcgtg
gtcaatggagactccttcacctgtgtctgcaaagaaggctgggaggggcctatttgtact
caaaataccaacgactgcagtccccatccttgttacaatagcgggacctgtgtggacgga
gacaactggtatcggtgcgaatgtgccccgggttttgctgggccagactgcaggataaac
atcaatgagtgccagtcttccccttgtgcctttggggccacctgtgtggatgagatcaat
ggctaccagtgtatctgccctccaggacatagtggtgccaagtgccatgaagtttcaggg
cgatcttgcatcaccatggggagagtgatacttgatggggccaagtgggatgatgactgt
aacacctgccagtgcctgaatggacgggtggcctgctccaaggtctggtgtggcccgaga
ccttgcaggctccacaaaagccacaatgagtgccccagtgggcagagctgcatcccggtc
ctggatgaccagtgtttcgtgcgcccctgcactggtgttggcgagtgtcggtcctccagc
ctccagccagtgaagaccaagtgcacatctgactcctattaccaggataactgtgcaaac
atcactttcacctttaacaaagagatgatgtctccaggtcttaccaccgaacacatttgc
agcgaattgaggaatttgaatatcctgaagaatgtttctgctgaatattcgatctacata
gcctgtgagccttccctgtcagcaaacaatgaaatacacgtggccatctctgcagaagac
atccgggatgatgggaaccctgtcaaggaaattaccgataaaataatagatctcgttagt
aaacgggatggaaacagctcacttattgctgcggttgcagaagtcagagttcagaggcgt
cctctgaaaaacagaacagatttcctggttcctctgctgagctctgtcttaacagtggct
tgggtctgttgcttggtgacagccttctactggtgtgtaaggaagcggcggaagcccagc
agccacactcactccgcccccgaggacaacaccaccaacaatgtgcgggagcagctgaac
caaatcaaaaaccccatcgagaaacacggagccaacacggtccccattaaggattacgag
aacaaaaactcgaaaatgtcaaaaatcaggacacacaactcggaagtggaggaggatgac
atggataaacaccagcagaaagtccgctttgccaaacagccagtgtatacgctggtagac
agagaggagaaggcccccagcggcacgccgacaaaacacccgaactggacaaataaacag
gacaacagagacttggaaagtgcccagagcttgaaccggatggaatacatcgtatag

DBGET integrated database retrieval system