KEGG   Mus musculus (mouse): 16450
Entry
16450             CDS       T01002                                 

Gene name
Jag2, D12Ggc2e, Se, Serh, mJagged2-1, sm
Definition
(RefSeq) jagged 2
  KO
K21635  jagged-2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    16450 (Jag2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16450 (Jag2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16450 (Jag2)
  09162 Cancer: specific types
   05224 Breast cancer
    16450 (Jag2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    16450 (Jag2)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA MFS_2
Other DBs
NCBI-GeneID: 16450
NCBI-ProteinID: NP_034718
MGI: 1098270
Ensembl: ENSMUSG00000002799
UniProt: Q9QYE5
Position
12 F1; 12 61.37 cM
AA seq 1247 aa
MRARGWGRLPRRLLLLLVLCVQATRPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGRDECDTYVRVCLKEYQAKVTPTGPCSYGYGATPVLGGNSFYLPPAGAAGDRARARSR
TGGHQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPDEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGKFCDECVPYPGCVHGSCVEPWHCDCETNWG
GLLCDKDLNYCGSHHPCVNGGTCINAEPDQYLCACPDGYLGKNCERAEHACASNPCANGG
SCHEVPSGFECHCPSGWNGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCLPGWKGINCQININDCHGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELEYDKCASSPCRRGGICEDLVDGFRCHCPRGLSGLHCEVDMDLC
EPSPCLNGARCYNLEGDYYCACPEDFGGKNCSVPRDTCPGGACRVIDGCGFEAGSRARGV
APSGICGPHGHCVSLPGGNFSCICDSGFTGTYCHENIDDCMGQPCRNGGTCIDEVDSFRC
FCPSGWEGELCDINPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCTIAKNSSCVPNPCVNGGTCVGSGDSFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRSGPRCQEVVIFTRPCWSRGMSFPHGSSWMEDCNSCRCLDGHRD
CSKVWCGWKPCLLSGQPSDPSAQCPPGQQCQEKAVGQCLQPPCENWGECTAEEPLPPSTP
CQPRSSHLDNNCARLTLRFNRDQVPQGTTVGAICSGIRALPATRAAAHDRLLLLLCDRAS
SGASAVEVAVSFSPARDLPDSSLIQSTAHAIVAAITQRGNSSLLLAVTEVKVETVVMGGS
STGLLVPVLCSVFSVLWLACVVICVWWTRKRRKERERSRLPRDESANNQWAPLNPIRNPI
ERPGGSGLGTGGHKDILYQCKNFTPPPRRAGEALPGPAGHGAGGEDEEDEELSRGDGDSP
EAEKFISHKFTKDPSCSLGRPARWAPGPKVDNRAVRSTKDVRRAGRE
NT seq 3744 nt   +upstreamnt  +downstreamnt
atgcgggcacgcggctggggacgcctgcctcggcggctgctgctgctactggttctgtgc
gtgcaggcgacgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacgacgcgcgcgggg
ggctgcggccgcgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggctacggcgccacgcccgtgctgggtggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgcgcgcggtctcgg
accggcggccaccaggacccgggcctcgtcgtcattccctttcagttcgcctggccgcgt
tctttcaccctcatcgtggaggcctgggactgggacaatgacaccactccagatgaggag
ctgctgattgagcgggtgtcgcacgctggcatgatcaaccccgaggaccgctggaagagc
ctgcacttcagcggccacgtggcacacctggagctgcagatccgagtacgctgtgatgag
aactactacagtgccacctgcaacaagttctgccggccccgcaacgacttctttggccac
tatacctgcgaccagtacggcaacaaggcctgcatggatggctggatgggcaaagaatgc
aaagaagccgtgtgtaaacaaggatgtaatttgctccacgggggatgcactgtgcctggg
gagtgcaggtgcagctacggctggcagggcaagttctgtgacgagtgtgtcccctaccct
ggctgcgtgcatggcagctgtgtggagccctggcactgtgactgtgagaccaactggggt
ggcctgctctgtgacaaagacctgaactactgtggcagccaccacccctgtgtcaacggg
ggtacctgcatcaatgctgagcctgaccaatacctctgcgcctgcccagatggctacttg
ggcaagaactgcgagcgggctgagcacgcctgtgcctccaacccgtgtgccaatgggggc
tcttgccacgaagtgccatctggctttgaatgccactgtccgtcaggatggaacggaccc
acctgtgcgctcgacattgatgagtgtgcctctaacccatgtgcagcgggtggtacctgc
gtggatcaggtggacggcttcgagtgcatctgcccggagcagtgggtgggggctacttgc
cagctggacgccaatgagtgtgaagggaagccgtgccttaatgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcctcccgggctggaagggcatcaactgccaaatc
aacatcaacgattgccatgggcagtgtcagcatgggggcacctgcaaggacctggtcaat
gggtaccagtgtgtgtgcccgcggggctttggaggtcgccattgcgaactagagtacgac
aagtgtgccagcagcccctgccgccggggtggcatctgtgaggacctggtggatggcttc
cgctgccactgcccacggggcctctctgggctgcactgtgaggtggacatggatctctgt
gaaccaagcccctgcctcaacggtgctcgctgctacaaccttgagggtgactactactgc
gcctgcccagaagactttggtggcaagaactgctcagtgcccagggacacatgccctggc
ggggcatgtagagtgatcgatggctgcgggttcgaggcagggtccagggcacgcggtgtc
gcaccctctggtatatgtggccctcacgggcactgcgttagcctgcctgggggaaacttc
tcctgcatctgtgacagcggcttcacaggcacctactgccatgaaaacattgacgactgc
atgggccagccctgccgcaacgggggcacgtgcattgacgaagtggactccttccgctgc
ttctgccccagtggctgggaaggagaactctgtgacatcaatcccaacgactgcctcccc
gacccctgccacagccgcggccgctgctatgacctggtcaatgacttctactgtgcctgt
gacgatggctggaagggcaagacctgccactcacgcgagttccagtgtgacgcctacacc
tgcagcaacggtggcacatgctatgacagcggcgacaccttccgctgcgcgtgccctccg
ggctggaagggcagcacctgcaccatcgccaagaacagcagctgtgtgcccaatccctgt
gtgaatggaggcacctgcgtgggcagcggagactctttctcctgcatctgccgggatggc
tgggagggccgcacctgcacacataacaccaatgactgcaaccctctgccctgctataac
ggaggcatctgtgttgatggcgtcaactggttccgctgcgagtgtgcgcctggctttgcg
ggtcctgactgccgtatcaacattgatgagtgccagtcctcgccctgtgcctacggagcc
acgtgtgtggatgagatcaacgggtaccgctgcagctgcccaccaggtcgttctggcccc
aggtgccaggaagtggtcatattcacgaggccctgctggtcccggggaatgtccttcccg
catgggagttcctggatggaagactgcaacagctgccgctgcctggatggccaccgggat
tgtagcaaggtatggtgcggatggaagccttgcctgctctctggtcagcccagcgatccg
agtgcccagtgccccccagggcagcaatgtcaggagaaggccgtgggtcagtgcttgcag
ccaccctgtgagaactggggggagtgtacagcggaggagcctctgccacccagcaccccc
tgtcagccacggagcagtcatttggacaacaactgtgcccgactcacactgcgcttcaac
cgtgatcaagtgcctcagggcaccaccgtgggcgctatctgctctggaatccgagccttg
cctgccacgagggcggcggcacacgaccgcctcctcctgctgctttgtgatcgagcatcc
tcgggggccagtgctgtggaggtggctgtgtctttcagccctgcaagggacctgcctgac
agcagcctgatccagagcacagcccacgccatcgtggctgctatcactcagagaggaaat
agctcactgctgctggctgtcaccgaggtcaaggtggaaacagttgttatgggtggctct
tccacaggtctgttggtgcccgtgctgtgcagcgtgttcagtgtgctgtggctcgcctgt
gtggttatctgcgtatggtggacacgaaagcgcaggaaagaacgtgagaggagccggcta
ccacgggatgagagcgccaacaaccagtgggccccgctcaatcccatccgcaaccccatt
gagcggccaggcggcagcggtctgggaactgggggccacaaggacatactctaccagtgc
aaaaacttcacaccgccgccccgcagggcaggcgaggcactgcccgggccagctggccat
ggggctggtggggaggacgaggaggatgaagagctgagccgtggagatggggactcccca
gaggcagagaagttcatctcacacaagttcaccaaagaccccagctgctccctcggaagg
ccagcccgctgggctccagggcccaaagtggacaaccgcgccgtcagaagtaccaaggac
gtgcgccgtgctggcagggaatag

DBGET integrated database retrieval system