KEGG   Mus musculus (mouse): 16451
Entry
16451             CDS       T01002                                 

Gene name
Jak1, AA960307, BAP0, BAP004, C130039L05Rik
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16451 (Jak1)
   04151 PI3K-Akt signaling pathway
    16451 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16451 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16451 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    16451 (Jak1)
   04658 Th1 and Th2 cell differentiation
    16451 (Jak1)
   04659 Th17 cell differentiation
    16451 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16451 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16451 (Jak1)
   05203 Viral carcinogenesis
    16451 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16451 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    16451 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16451 (Jak1)
   05161 Hepatitis B
    16451 (Jak1)
   05160 Hepatitis C
    16451 (Jak1)
   05171 Coronavirus disease - COVID-19
    16451 (Jak1)
   05164 Influenza A
    16451 (Jak1)
   05162 Measles
    16451 (Jak1)
   05168 Herpes simplex virus 1 infection
    16451 (Jak1)
   05163 Human cytomegalovirus infection
    16451 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16451 (Jak1)
   05169 Epstein-Barr virus infection
    16451 (Jak1)
   05165 Human papillomavirus infection
    16451 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16451 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16451 (Jak1)
   05140 Leishmaniasis
    16451 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16451 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16451 (Jak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16451 (Jak1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   16451 (Jak1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 ABC1 RIO1 SH2 TCAD9
Other DBs
NCBI-GeneID: 16451
NCBI-ProteinID: NP_038595
MGI: 96628
Ensembl: ENSMUSG00000028530
Vega: OTTMUSG00000008208
Position
4 C6; 4 46.19 cM
AA seq 1052 aa
MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKRVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELS
RCHSNDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLEYNKHKKDDERNKLR
EEWNNFSYFPEITHIVIKESVVSINKQDNKNMELKLSSREEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSMDHFPSLRDLMNHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGT
LLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSDIGPFIKLSDPGIPVSVLTRQDPDIVSEKQPTTEVDPTHFEKRFLKRIRDLG
EGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKG
ICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHR
DLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIAS
DVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPD
EVYQLMRKCWEFQPSNRTTFQNLIEGFEALLK
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggcgttctgtgctaaaatgagg
agcttcaagaagactgaggtgaagcaggtggtccctgagcctggagtggaggtgactttc
tatctgttggacagggagcccctccgcctgggcagcggagagtatacagccgaggagctg
tgcatcagggccgcccaggagtgcagtatctctcctctctgtcacaacctcttcgccctg
tacgatgagagcaccaagctctggtacgctccgaaccgaatcatcactgtggatgacaaa
acgtctctccggctccactaccgcatgaggttctactttaccaactggcacggaaccaat
gacaacgaacagtctgtatggcgacattctccaaagaagcagaaaaacggctatgagaag
aaaagggttccagaagcaaccccactccttgatgccagttcactggagtatctgtttgca
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacggagcaa
gacggacatgatattgaaaatgagtgcctgggcatggcggtcctggccatctcccactat
gccatgatgaagaagatgcagttgccggaacttcccaaagacatcagctacaagcgatat
attccagaaacattgaataaatccatcagacagaggaaccttcttaccaggatgcgaata
aataatgttttcaaggatttcttgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtctacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggagctgaaatatttgagacttctatgctactgatttcatcagaaaatgaattgagt
cgatgccattcgaatgacagtggcaatgttctctatgaggtcatggtgactggaaatctc
gggatccagtggcggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggaatataataaacacaagaaggatgatgagagaaacaaactccgg
gaagagtggaacaatttttcctatttccctgaaatcacccacattgtaataaaggagtct
gtggtcagcattaacaaacaggacaacaaaaacatggaactcaagctctcttctcgagag
gaagccttgtcctttgtgtccctggtggatggctacttccggctcactgcagatgcccac
cattacctctgtactgatgtggctcccccactgattgtccacaatatacagaacggctgc
cacggtccaatctgcacagaatatgccatcaataagctgcggcaggaagggagtgaagag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacattcttatgactgtcacc
tgctttgaaaagtctgaggtattgggtggccagaagcagttcaagaactttcagattgag
gtacagaagggccgctacagcctgcatggctctatggaccactttcccagcctgcgagac
ctcatgaaccacctcaagaagcagatcctgcgcacggacaacataagctttgtgctgaaa
cgatgctgtcagcctaagcctcgagaaatctccaatctgctcgtagccactaagaaagcc
caggagtggcagcctgtctactccatgagccagctgagctttgatcggatccttaagaaa
gatattatacaaggtgagcaccttggcagaggcacaagaacacatatctattctgggacc
ctgctggactacaaggatgaggaaggaattgctgaagagaagaagataaaagtgatcctc
aaagtcctagaccccagccaccgggacatctctctggccttctttgaggctgctagcatg
atgagacaggtttcccacaaacatatagtgtacctctacggcgtgtgtgtccgagatgtg
gaaaatatcatggtggaagagtttgtggagggggggccgttggatctcttcatgcaccgg
aaaagtgatgcgcttactaccccctggaagttcaaggttgccaaacagctggccagtgcc
ctgagttacttggaagataaagacctggttcatggaaatgtgtgcactaaaaacctcctt
ctggcccgtgagggcattgacagtgacattggcccgttcatcaagcttagtgaccctggc
atcccagtctctgtgctgaccaggcaagatccagacattgtttcagaaaagcagccaaca
acagaggtggaccccactcactttgaaaagcggttcctgaagaggattcgtgacttggga
gagggtcactttgggaaggttgagctctgcagatatgatcctgagggagacaacacaggg
gagcaggtagctgtcaagtccctgaagcctgagagtggaggtaaccacatagctgatctg
aagaaggagatagagatcttacggaacctctaccatgagaacattgtgaagtacaaagga
atctgcatggaagacggaggcaatggtatcaagctcatcatggagtttctgccttcggga
agcctaaaggagtatctgccaaagaataagaacaaaatcaacctcaaacagcagctaaaa
tatgccatccagatttgtaaggggatggactacttgggttctcggcaatacgttcaccgg
gacttagcagcaagaaatgtccttgttgagagtgagcatcaagtgaagatcggagacttt
ggtttaaccaaagcaattgaaaccgataaggagtactacacagtcaaggacgaccgggac
agcccagtgttctggtacgctccggaatgtttaatccagtgtaaattttatatcgcctct
gatgtctggtcttttggagtgacactgcacgagctgctcacttactgtgactcagatttt
agtcccatggccttgttcctgaaaatgataggcccaactcatggccagatgacagtgaca
cggcttgtgaatactctgaaagaaggaaagcgtctgccatgtccacccaactgtcctgat
gaggtttatcagcttatgagaaaatgctgggaattccaaccatctaaccggacaactttt
cagaaccttattgaaggatttgaagcacttttaaaataa

KEGG   Mus musculus (mouse): 54721
Entry
54721             CDS       T01002                                 

Gene name
Tyk2, JTK1
Definition
(RefSeq) tyrosine kinase 2
  KO
K11219  non-receptor tyrosine-protein kinase TYK2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    54721 (Tyk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    54721 (Tyk2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    54721 (Tyk2)
   04658 Th1 and Th2 cell differentiation
    54721 (Tyk2)
   04659 Th17 cell differentiation
    54721 (Tyk2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    54721 (Tyk2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    54721 (Tyk2)
   05160 Hepatitis C
    54721 (Tyk2)
   05171 Coronavirus disease - COVID-19
    54721 (Tyk2)
   05164 Influenza A
    54721 (Tyk2)
   05162 Measles
    54721 (Tyk2)
   05168 Herpes simplex virus 1 infection
    54721 (Tyk2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    54721 (Tyk2)
   05169 Epstein-Barr virus infection
    54721 (Tyk2)
   05165 Human papillomavirus infection
    54721 (Tyk2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    54721 (Tyk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    54721 (Tyk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     54721 (Tyk2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   54721 (Tyk2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Jak1_Phl FERM_F2 FERM_F1 Kdo Kinase-like APH
Other DBs
NCBI-GeneID: 54721
NCBI-ProteinID: NP_061263
MGI: 1929470
Ensembl: ENSMUSG00000032175
Vega: OTTMUSG00000063155
UniProt: Q9R117
Structure
PDB: 
4E1Z 4E20

Position
9; 9 A3
AA seq 1184 aa
MVGTMPLCGRRAILEDSKADGTEAQPLVPTGCLMVLLHWPGPEGGEPWVTFSQTSLTAEE
VCIHIAHKVGITPPCLNLFALYNAQAKVWLPPNHILDTSQDMNLYFRMRFYFRNWHGMNP
QEPAVYRCGFPGAETSSDRAEQGVQLLDSASFEYLFEQGKHEFMNDVVSLRDLSSEEEIH
HFKNESLGMAFLHLCHLALSRGVPLEEMAREISFKNCIPHSFRQHIRQHNVLTRLRLHRV
FRRFLRAFRPGHLSQQVVMVKYLATLERLAPRFGSERIPVCHLEVLAQPERDPCYIQNSG
QTAGDPGPELPSGPPTHEVLVTGTGGIQWHPLQTQESERGNSRGNPHGSRSGKKPKAPKA
GEHLTESPQEPPWTYFCDFQDISHVVLKERRVHIHLQDNKCLLLCLCSQAEALSFVALVD
GYFRLTADSSHYLCHEVAPPRLVTSIQNGIHGPLMDPFVQAKLWPEDGLYLIQWSTSHLH
RLILTVAHRNPAFSNGPRGLRLRKFPITQQPGAFVLDGWGRSFASLGDLRLALQGCSLRA
GDDCFPLHHCCLPRPREISNLVIMRGSRAHTRPLNLSQLSFHRVHQDEITQLSHLGQGTR
TNVYEGLLRVGGPDEGKVDNGCPPEPGGTSGQQLRVVLKVLDPSHHDIALAFYETASLMS
QVSHMHLAFLHGVCVRGSENIIVTEFVEHGPLDVWLRRQRGQVPMTWKMVVAQQLASALS
YLEDKNLVHGNVCGRNILLARLGLEEGTNPFIKLSDPGVGQGALSREERVERIPWTAPEC
LSGGTSSLGTATDMWGFGATLLEICFDGEAPLQGRGPSEKERFYTKKHQLPEPSSPELAT
LTRQCLTYEPAQRPSFRTILRDLTRLQPQNLVGTSAVNSDSPASDPTVFHKRYLKKIRDL
GEGHFGKVSLYCYDPTNDGTGEMVAVKALKEGCGPQLRSGWQREIEILRTLYHEHIVKYK
GCCEDQGEKSVQLVMEYVPLGSLRDYLPRHCVGLAQLLLFAQQICEGMAYLHAQHYIHRD
LAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASD
VWSFGVTLYELLTYCDSNQSPHMKFTELIGHTQGQMTVLRLTELLERGERLPRPDRCPCE
IYHLMKNCWETEASFRPTFQNLVPILQTAQEKYQGQVPSVFSVC
NT seq 3555 nt   +upstreamnt  +downstreamnt
atggtggggaccatgcctctgtgtgggcggagagccatcttggaagacagcaaggcagat
ggcacagaagctcagcccctggtgcccacaggatgcttgatggtgctactgcattggcct
gggcctgagggcggggagccctgggtcaccttcagccagacatctctgactgcagaggag
gtctgcatccacatcgcacacaaagtcggcatcactccaccctgcttgaatctcttcgca
ctctacaatgcacaggctaaggtctggctgcccccaaaccatattctggatacatcccaa
gacatgaacctctattttcgaatgaggttttacttccggaactggcatggcatgaatccc
caggagccagctgtataccggtgtggtttcccaggggcagagacttcctcagaccgggca
gagcaaggtgtacagctcttggactctgcctcgtttgaatacctttttgagcagggaaag
catgagttcatgaacgatgtggtgtctctgcgggacctgtctagcgaggaggagatccac
cactttaagaatgagagcttaggcatggccttcctgcacctgtgtcaccttgctctcagc
cgaggcgtccccctggaggagatggccagagagatcagcttcaagaactgcatccctcat
tccttccgacagcacatccggcagcacaatgtgctcacacgcctgcggctccacagagtc
ttccgccgcttcctgcgggccttccggcctggccacctctcccagcaggttgtgatggtg
aagtacttggctaccctggagcggctggctccgcgctttggctcagagcgcatacctgtg
tgtcatctggaggtcctggcacagcccgagagggacccctgctacatccagaacagtggg
cagaccgctggggatccaggcccagagctgccttccgggcctcccacccacgaggtactg
gtgacaggcaccggaggtatccagtggcatccgctgcagacccaggaatctgagagaggt
aacagcagagggaatccccacggcagccggtcggggaagaagcccaaagcccccaaggct
ggagagcacctgacagagagccctcaggaaccaccttggacctacttctgtgacttccag
gacatttcccacgtggtgctaaaggagcgtcgcgtgcacatccacctccaagacaacaag
tgcttgttgctgtgcctctgttcccaggctgaggccctgtcctttgtggccctggtcgat
ggctatttccgcttgactgctgactccagccactatctgtgccatgaggtggcacccccg
aggctggtgactagcatccagaacggcatccatgggcccctgatggatccgtttgtacag
gccaagctgtggccagaggacggcctctacctgattcagtggagcaccagccacctgcac
cgcctgatccttaccgtggcccatcgaaacccggctttcagtaatggccctcggggcctg
cgcctgcgaaagttccccatcacacagcagcctggagcctttgtgctggatggctggggc
cgctcctttgccagcttgggggaccttcggctcgccttgcagggctgctcgttgcgggcc
ggtgatgactgtttccccctgcaccactgctgcctgccccggccaagagaaatctccaac
ctcgtcatcatgcgggggtctagggcccacacccggcctctcaacctcagtcagctcagc
ttccacagggttcaccaggatgaaatcacccagctgtcccacttgggccaaggcacaagg
accaatgtgtatgagggccttctaagagtgggaggccccgatgagggcaaagtggacaat
ggatgtccccctgagcctggtgggactagtgggcagcagcttcgagtggtgctcaaagtt
ctcgaccccagtcaccatgatatcgccttggccttctatgagactgctagcctcatgagc
caggtgtcacacatgcacctggctttcctgcatggtgtttgcgtgcgtggctcagagaat
atcattgtgacagaattcgtagaacatggtcccttggatgtgtggttacggcgacagagg
ggccaagtgcccatgacctggaagatggtcgtggctcagcagctggccagcgccctcagc
tacctggaggacaagaatctggttcacgggaatgtatgtggccggaacatcctgctggct
cgcctggggttggaggagggtaccaaccccttcatcaagctaagtgatcctggtgtgggc
cagggtgccctctccagggaagagcgggtggagcgcatcccctggacagctcccgagtgc
ctgtctggagggaccagtagcttgggtactgccacggacatgtggggctttggtgccacc
cttcttgagatctgctttgatggggaggcacccctgcagggtcgtggtccctctgagaaa
gaacggttctacacaaagaaacatcagctgcctgaaccctcatccccagagctggccaca
ctcacccgccagtgcctgacctatgaaccagcacagcggccatccttccgcaccattttg
cgggacctcacaaggctgcagccacagaatctagtcggcacttcggctgtgaactcagac
tcaccagcatcagaccccactgttttccacaagcgctatttgaaaaagatccgggatttg
ggtgagggtcactttggcaaggtcagcctgtactgctacgacccaaccaatgacggcact
ggcgagatggtggccgtgaaggccctgaaggaagggtgcggtccccagctccgctcaggc
tggcagcgggagatcgagatcctgcggacgctgtaccacgaacatattgtcaagtataaa
ggctgctgtgaggaccaaggagagaagtctgtacagctggtcatggagtacgtccctctg
ggcagcctccgagactacctgccaaggcactgcgtagggctggcgcagctcctgctgttt
gcccagcagatctgcgagggcatggcctacctgcacgctcagcactacattcaccgagac
ctcgccgcgcgcaacgtgctgctggacaacgacaggctggtcaagattggagactttggc
ctagccaaggctgtacctgaaggccacgagtactaccgagtgcgcgaggacggggacagc
ccagtgttctggtatgccccagaatgcctgaaggagtgcaaattttactatgcatctgat
gtctggtccttcggggtaactctgtatgagttgttgacatactgtgactctaaccagagt
ccccatatgaaattcaccgagctcatcggccatacccagggccagatgaccgtgctgagg
ctcacagagctgctggaacgaggagagaggctgcctcggcctgacaggtgtccctgtgag
atctatcacctcatgaagaactgctgggagacagaggcctccttccggcccaccttccag
aatcttgtgcccatcctccagacagcacaggagaagtaccaaggtcaggtgccttccgtg
ttcagcgtgtgctga

DBGET integrated database retrieval system