KEGG   Mus musculus (mouse): 16452Help
Entry
16452             CDS       T01002                                 

Gene name
Jak2, Fd17
Definition
(RefSeq) Janus kinase 2
  KO
K04447  Janus kinase 2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04725  Cholinergic synapse
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16452 (Jak2)
   04151 PI3K-Akt signaling pathway
    16452 (Jak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16452 (Jak2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16452 (Jak2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16452 (Jak2)
   04659 Th17 cell differentiation
    16452 (Jak2)
   04062 Chemokine signaling pathway
    16452 (Jak2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    16452 (Jak2)
   04917 Prolactin signaling pathway
    16452 (Jak2)
   04935 Growth hormone synthesis, secretion and action
    16452 (Jak2)
  09156 Nervous system
   04725 Cholinergic synapse
    16452 (Jak2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16452 (Jak2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16452 (Jak2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    16452 (Jak2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16452 (Jak2)
  09172 Infectious disease: viral
   05164 Influenza A
    16452 (Jak2)
   05161 Hepatitis B
    16452 (Jak2)
   05168 Herpes simplex virus 1 infection
    16452 (Jak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16452 (Jak2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16452 (Jak2)
   05140 Leishmaniasis
    16452 (Jak2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16452 (Jak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16452 (Jak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16452 (Jak2)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   16452 (Jak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl SH2 RIO1 Kinase-like FERM_M
Motif
Other DBs
NCBI-GeneID: 16452
NCBI-ProteinID: NP_001041642
MGI: 96629
Ensembl: ENSMUSG00000024789
UniProt: Q62120 G5E852
Structure
PDB: 

Position
19 C1; 19 23.73 cM
AA seq 1132 aa AA seqDB search
MGMACLTMTEMEATSTSPVHQNGDIPGSANSVKQIEPVLQVYLYHSLGQAEGEYLKFPSG
EYVAEEICVAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHDILYRIRFYF
PHWYCSGSSRTYRYGVSRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKEKDQTPLAVYNSVSYKTFLPKCVRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEQFEVKESARGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDVQLYCDFPDIIDVSIKQANQECSNESRIVTVHKQDGKVLEIELSSLK
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIHSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENGEYNLSGTKRNFSNLKDLLNC
YQMETVRSDSIIFQFTKCCPPKPKDKSNLLVFRTNGISDVQISPTLQRHNNVNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHKTEVLLKVLDKAHRNYSESFFEAASM
MSQLSHKHLVLNYGVCVCGEENILVQEFVKFGSLDTYLKKNKNSINILWKLGVAKQLAWA
MHFLEEKSLIHGNVCAKNILLIREEDRRTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDKHQLPAPKWTEL
ANLINNCMDYEPDFRPAFRAVIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLRLIMEYLPYGSLRDYLQKHKERIDHKKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPVEFMRMIGNDKQGQMIVFHLIE
LLKSNGRLPRPEGCPDEIYVIMTECWNNNVSQRPSFRDLSLRVDQIRDSIAA
NT seq 3399 nt NT seq  +upstreamnt  +downstreamnt
atgggaatggcctgccttacaatgacagaaatggaggcaacctccacatctcctgtacat
cagaatggtgatattcctggaagtgctaattctgtgaagcagatagagccagtccttcaa
gtgtatctgtaccattctcttgggcaagctgaaggagagtatctgaagtttccaagtgga
gagtatgttgcagaagaaatttgtgtggctgcttctaaagcttgtggtattacgcctgtg
tatcataatatgtttgcgttaatgagtgaaaccgaaaggatctggtacccacccaatcat
gtcttccacatagacgagtcaaccaggcatgacatactctacaggataaggttctacttc
cctcattggtactgtagtggcagcagcagaacctacagatacggagtgtcccgtggggct
gaagctcctctgcttgatgactttgtcatgtcttacctttttgctcagtggcggcatgat
tttgttcacggatggataaaagtacctgtgactcatgaaactcaggaagagtgtcttggg
atggcggtgttagacatgatgagaatagctaaggagaaagaccagactccactggctgtc
tataactctgtcagctacaagacattcttaccaaagtgcgttcgagcgaagatccaagac
tatcacattttaacccggaagcgaatcaggtacagatttcgcagattcattcagcaattc
agtcaatgtaaagccactgccaggaacctaaaacttaagtatcttataaacctggaaacc
ctgcagtctgccttctacacagaacagtttgaagtaaaagaatctgcaagaggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaggaaagtgagacactgacagaacaggacgtacagttatattgtgatttc
cctgatattattgatgtcagtattaagcaagcaaaccaggaatgctcaaatgaaagtaga
attgtaactgtccataaacaagatggtaaagttttggagatagaacttagctcattaaaa
gaagccttgtcattcgtgtcattaattgacgggtattacagactaactgcggatgcgcac
cattacctctgcaaagaggtggctcccccagctgtgctcgagaacatacacagcaactgc
cacggcccaatatcaatggattttgccattagcaaactaaagaaggcgggtaaccagact
ggactatatgtgctacgatgcagccctaaggacttcaacaaatactttctgacctttgct
gttgagcgagaaaatgtcattgaatataaacactgtttgattacgaagaatgagaatgga
gaatacaacctcagcgggactaagaggaacttcagtaaccttaaggaccttttgaattgc
taccagatggaaactgtgcgctcagacagtatcatcttccagtttaccaaatgctgcccc
ccaaagccaaaagataaatcaaaccttctcgtcttcagaacaaatggtatttctgatgtt
cagatctcaccaacattacagaggcataataatgtgaatcaaatggtgtttcacaaaatc
aggaatgaagatttaatatttaatgaaagtcttggccaaggtacttttacaaaaattttt
aaaggtgtaagaagagaagttggagattatggtcaactgcacaaaacggaagttcttttg
aaagtcctagataaagcacataggaactattcagagtctttcttcgaagcagcaagcatg
atgagtcagctttctcacaagcatttggttttgaattatggtgtctgtgtctgtggagag
gagaacattctggttcaagaatttgtaaaatttggatcactggatacatacctgaagaag
aacaaaaattccataaatatattatggaaacttggagtggctaagcagttggcatgggcc
atgcattttctagaagaaaaatcccttattcatgggaatgtgtgtgctaaaaatatcctg
cttatcagagaagaagacaggagaacggggaacccacctttcatcaaacttagtgatcct
ggcattagcattacagttctaccgaaggacattcttcaggagagaataccatgggtacct
cctgaatgcattgagaatcctaaaaatctcaatctggcaacagacaagtggagcttcggg
accactctgtgggagatctgcagtggaggagataagcccctgagtgctctggattctcaa
agaaagctgcagttctatgaagataagcatcagcttcctgcacccaagtggacagagtta
gcaaaccttataaataattgcatggactatgagccagatttcaggcctgctttcagagct
gtcatccgtgatcttaacagcctgtttactccagattatgaactactaacagaaaatgac
atgctaccaaacatgagaataggtgccctagggttttctggtgcttttgaagacagggac
cctacacagtttgaagagagacacttgaagtttctacagcagcttggcaaaggtaacttc
gggagtgtggagatgtgccgctatgacccgctgcaggacaacactggcgaggtggtcgct
gtgaagaaactccagcacagcactgaagagcacctccgagactttgagagggagatcgag
atcctgaaatccttgcagcatgacaacatcgtcaagtacaagggagtgtgctacagtgcg
ggtcggcgcaacctaagattaattatggaatatttaccatatggaagtttacgagactat
ctccaaaaacataaagaacggatagatcacaaaaaacttcttcaatacacatctcagata
tgcaagggcatggaatatcttggtacaaaaaggtatatccacagggacctggcaacaagg
aacatattggtggaaaatgagaacagggttaaaataggagacttcggattaaccaaagtc
ttgccgcaggacaaagaatactacaaagtaaaggagccaggggaaagccccatattctgg
tacgcacctgaatccttgacggagagcaagttttctgtggcctcagatgtgtggagcttt
ggagtggttctatacgaacttttcacatacatcgagaagagtaaaagtccacccgtggaa
tttatgcgaatgattggcaatgataaacaagggcaaatgattgtgttccatttgatagag
ctactgaagagcaacggaagattgccaaggccagaaggatgcccagatgagatttatgtg
atcatgacagagtgctggaacaacaatgtgagccagcgtccctccttcagggacctttcc
cttcgggtggatcaaatccgggacagtatagctgcgtga

DBGET integrated database retrieval system