KEGG   Mus musculus (mouse): 16453
Entry
16453             CDS       T01002                                 

Gene name
Jak3, fae, wil
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  JAK-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05223  Non-small cell lung cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    16453 (Jak3)
   04151 PI3K-Akt signaling pathway
    16453 (Jak3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16453 (Jak3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16453 (Jak3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    16453 (Jak3)
   04659 Th17 cell differentiation
    16453 (Jak3)
   04062 Chemokine signaling pathway
    16453 (Jak3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16453 (Jak3)
   05203 Viral carcinogenesis
    16453 (Jak3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    16453 (Jak3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16453 (Jak3)
   05161 Hepatitis B
    16453 (Jak3)
   05162 Measles
    16453 (Jak3)
   05169 Epstein-Barr virus infection
    16453 (Jak3)
  09163 Immune disease
   05340 Primary immunodeficiency
    16453 (Jak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16453 (Jak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16453 (Jak3)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   16453 (Jak3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH ABC1 Kdo pKID Haspin_kinase
Other DBs
NCBI-GeneID: 16453
NCBI-ProteinID: NP_001177759
MGI: 99928
Ensembl: ENSMUSG00000031805
Vega: OTTMUSG00000021111
UniProt: Q62137 A0A0R4J0R7
Position
8 B3.3; 8 34.43 cM
AA seq 1100 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQRLSFSFGDYLAEDLCVRAAKA
CGILPVYHSLFALATEDFSCWFPPSHIFCIEDVDTQVLVYRLRFYFPDWFGLETCHRFGL
RKDLTSAILDLHVLEHLFAQHRSDLVSGRLPVGLSMKEQGEFLSLAVLDLAQMAREQAQR
PGELLKTVSYKACLPPSLRDVIQGQNFVTRRRIRRTVVLALRRVVACQADRYALMAKYIL
DLERLHPAATTETFRVGLPGAQEEPGLLRVAGDNGISWSSGDQELFQTFCDFPEIVDVSI
KQAPRVGPAGEHRLVTVTRMDGHILEAEFPGLPEALSFVALVDGYFRLICDSRHYFCKEV
APPRLLEEEAELCHGPITLDFAIHKLKAAGSLPGTYILRRSPQDYDSFLLTACVQTPLGP
DYKGCLIRQDPSGAFSLVGLSQPHRSLRELLAACWNSGLRVDGAALNLTSCCAPRPKEKS
NLIVVRRGCTPAPAPGCSPSCCALTQLSFHTIPTDSLEWHENLGHGSFTKIFRGRRREVV
DGETHDSEVLLKVMDSRHRNCMESFLEAASLMSQVSYPHLVLLHGVCMAGDSIMVQEFVY
LGAIDMYLRKRGHLVSASWKLQVTKQLAYALNYLEDKGLPHGNVSARKVLLAREGGDGNP
PFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEAQTLGLEADKWGFGATTWEVFSGGPA
HITSLEPAKKLKFYEDQGQLPALKWTELAGLITQCMAYDPGRRPSFRAILRDLNGLITSD
YELLSDPTPGIPSPRDELCGGAQLYACQDPAIFEERHLKYISLLGKGNFGSVELCRYDPL
GDNTGPLVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRLVMEY
LPSGCLRDFLQRHRARLHTDRLLLFAWQICKGMEYLGARRCVHRDLAARNILVESEAHVK
IADFGLAKLLPLGKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYC
DKSCSPSAEFLSMMGPEREGPPLCRLLELLAEGRRLPPPPTCPTEVQELMQLCWAPSPHD
RPAFGTLSPQLDALWRGRPG
NT seq 3303 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacacctctgatccctcagcgctcttgcagcctctcatcc
tcagaggcaggagccctgcatgtgctccttcctccccggggacctgggcctccccagcga
ttgtcattctcttttggggactacttggctgaggatttatgtgtgcgagctgccaaggcc
tgtggcatcctgcctgtttatcattcgcttttcgctctggccactgaggacttctcttgc
tggtttcccccaagccacatcttctgcatagaggacgtggacactcaagtcttggtctac
aggctacgcttttatttccctgactggtttgggctggagacatgtcaccgctttgggctg
cgcaaagatttgaccagtgccatccttgacttacacgttttagaacatctctttgctcag
caccgcagtgacctggtgagtgggcgcctcccggtgggccttagcatgaaggagcaggga
gagttcctgagcctggccgtgctggacttggcccagatggctcgtgagcaggcccagcgc
ccaggagagctgctgaagacggtcagttacaaagcctgtctgccgcccagcctgcgcgat
gtgatccagggccagaacttcgtgacacgcaggcgcatccgcaggaccgtggtcttggcg
ctgcgccgtgtggtcgcctgccaggccgaccgctacgcgctcatggccaagtatattttg
gacctggagcggctacatccagcggccaccaccgagaccttccgtgtggggctcccgggc
gcccaggaggagccggggcttctgcgtgtggcgggggacaacggcatctcctggagctcc
ggggaccaggagcttttccagaccttctgtgactttccggaaatcgtggatgtcagcatc
aagcaggccccacgtgtgggtccggcaggggaacaccggctggtcaccgtcaccaggatg
gacggccacatcctggaagcggagtttccggggctgcctgaggcgctgtccttcgtggcc
cttgtggatgggtacttccgcctgatctgcgactccaggcattatttctgcaaggaggtg
gcgccgccgcggctgctggaggaggaggcggagctgtgccatggacccatcacgttagac
tttgccatccacaagctgaaggccgctggctccctcccaggcacctacattctccgccgc
agcccgcaggactatgacagctttcttcttaccgcctgcgtccagactcctcttggcccc
gactacaagggctgcctcatccgccaggaccccagcggggctttctccctggttggcctc
agccagccccacagaagcctgcgggagctgcttgcagcctgctggaattctgggctgcga
gtagacggtgctgccctgaacctaacatcctgctgcgctcccagacccaaggaaaagtcc
aatttgatcgtggtgcgaaggggctgcacccccgcgcctgcccctggctgctccccgtcc
tgctgtgcgctgacacagctgagcttccacacaattccaacggacagcctggagtggcac
gagaacctgggtcacggttcttttaccaagatcttccgtggccgcaggcgggaggtcgtg
gatggtgagacacatgactcggaagtcctcctgaaggtcatggactccagacatcggaac
tgcatggagtcttttctggaagccgcaagcttgatgagccaagtatcctacccgcacctg
gtgttactgcacggcgtctgcatggctggagacagcatcatggtgcaggaatttgtgtat
ctaggagcaattgacatgtacctgcgcaagcgtggccacctggtgtcagccagctggaaa
ctgcaggtgaccaagcagctggcatatgcccttaactacttggaggacaaaggccttcct
cacggcaacgtctcagcacggaaggtgctcctggctcgtgaggggggtgatgggaatcca
cctttcattaagctgagtgatcctggtgtcagtcccactgtgctgagcctggaaatgctc
accgacagaataccctgggtggcccccgaatgtctccaggaggctcagacactcggcttg
gaggctgacaagtggggctttggagccaccacgtgggaggtgttcagcgggggacccgcc
cacatcacctcgctggagcccgccaaaaagctgaagttctatgaggaccagggacagctg
cccgctctcaaatggacagaactggcgggacttatcacacagtgcatggcctatgatcct
ggccggcgcccctccttccgagctatcctcagagacctcaacggcctcattacatcagat
tacgagctcctctcagaccccacacctggcatcccgagtcctcgagatgagctgtgcggt
ggcgcccagctctatgcctgccaggaccccgccatattcgaggagagacaccttaagtac
atctctttgctgggcaagggcaactttggcagcgtggagctgtgccgctatgaccccctg
ggggacaatacgggacccctggtggcagtgaaacagctacagcacagcgggccagaccag
cagagggacttccagcgggagattcagatccttaaggctctgcacagcgacttcatcgtc
aagtaccggggagtcagctatgggccaggtcgccagagcctgcggttggtgatggagtac
ctgcccagcggctgcctgcgagacttcctgcagcgccatcgcgcgcgcctgcacaccgac
cgcctactgctgttcgcttggcagatctgcaagggcatggagtacctgggtgcgcgccgc
tgcgtacaccgtgacctggctgcgcgcaacatcttggtggagagcgaggctcatgtgaag
atcgcggacttcggcctcgctaagctgctgcccctgggaaaggactactacgtggtccgc
gagcctggccaaagccccatcttttggtatgccccggagtccctatctgacaacatcttc
tcccgccaatctgacgtgtggagcttcggagtggtgttgtacgagctcttcacctactgc
gacaagagctgcagcccatccgctgagttcctgagcatgatggggcctgagcgtgaagga
cccccgctctgccgcctcctggagctgctggcagagggccgacgcctcccaccacctccc
acctgccccaccgaggttcaggagctcatgcagctgtgctgggcgcccagcccgcacgac
cggccagccttcggcaccctgagcccccagctggacgcgctgtggcgtggaagacccgga
tag

DBGET integrated database retrieval system