KEGG   Mus musculus (mouse): 16456Help
Entry
16456             CDS       T01002                                 

Gene name
F11r, 9130004G24, AA638916, ESTM33, JAM, JAM-1, JAM-A, Jcam, Jcam1, Ly106
Definition
(RefSeq) F11 receptor
  KO
K06089  junctional adhesion molecule 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04514  Cell adhesion molecules (CAMs)
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    16456 (F11r)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    16456 (F11r)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    16456 (F11r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16456 (F11r)
CD molecules [BR:mmu04090]
 Proteins
  16456 (F11r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set C1-set Ig_6 C2-set_2 Adeno_E3_CR1 Ig_C17orf99 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 16456
NCBI-ProteinID: NP_766235
MGI: 1321398
Ensembl: ENSMUSG00000038235
Vega: OTTMUSG00000021724
UniProt: O88792
Structure
PDB: 

Position
1 H3; 1 79.43 cM
AA seq 300 aa AA seqDB search
MGTEGKAGRKLLFLFTSMILGSLVQGKGSVYTAQSDVQVPENESIKLTCTYSGFSSPRVE
WKFVQGSTTALVCYNSQITAPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEEGGQNYGE
VSIHLTVLVPPSKPTISVPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGISMLTADAKKT
RAFMNSSFTIDPKSGDLIFDPVTAFDSGEYYCQAQNGYGTAMRSEAAHMDAVELNVGGIV
AAVLVTLILLGLLIFGVWFAYSRGYFERTKKGTAPGKKVIYSQPSTRSEGEFKQTSSFLV
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgaggggaaagccgggaggaaactgttgtttctcttcacgtctatgatcctg
ggctctttggtacaaggcaagggttcggtgtacactgctcaatctgacgtccaggttccc
gagaacgagtccatcaaattgacctgcacctactctggcttctcctctccccgagtggag
tggaagttcgtccaaggcagcacaactgcacttgtgtgttataacagccagatcacagct
ccctatgcggaccgagtcaccttctcatccagtggcatcacgttcagttctgtgacccgg
aaggacaatggagagtatacttgcatggtctccgaggaaggtggccagaactacggggag
gtcagcatccacctcactgtgcttgtacctccatccaagccgacgatcagtgtcccctcc
tctgtcaccattgggaacagggcagtgctgacctgctcagagcatgatggttccccaccc
tctgaatattcctggttcaaggacgggatatccatgcttacagcagatgccaagaaaacc
cgggccttcatgaattcttcattcactattgatccaaagtcgggggatctgatctttgac
cccgtgacagcctttgatagtggtgaatactactgccaggcccagaatggatatgggaca
gccatgaggtcagaggctgcacacatggatgctgtggagctgaatgtggggggcatcgtg
gcagctgtcctggtaacactgattctccttggactcttgatttttggcgtctggtttgcc
tatagccgtggatactttgaaagaacaaagaaagggactgcaccgggtaagaaggtcatt
tacagccagcccagtactcgaagtgagggggaattcaaacagacctcgtcgttcctggtg
tga

DBGET integrated database retrieval system