KEGG   Mus musculus (mouse): 16469
Entry
16469             CDS       T01002                                 

Gene name
Jrk
Definition
(RefSeq) jerky
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DDE_1 CENP-B_N HTH_Tnp_Tc5 HTH_7
Other DBs
NCBI-GeneID: 16469
NCBI-ProteinID: NP_032441
MGI: 106214
Ensembl: ENSMUSG00000046380
Vega: OTTMUSG00000023665
UniProt: Q60976 Q543Z9
Position
15 D3; 15 34.26 cM
AA seq 557 aa
MASKQAAAKGKGEKRKRVVLTLKEKIDICTRLERGESRKALMQEYNVGMSTLYDIKAHKA
QLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFY
KQMRLTEPCVFSGGWLWRFKARHGIKKLDASSEKQAADHQAAEQFCGFFRSLAAEHGLSP
EQVYSADETGLVWRCLPNSAPDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGG
PRAFRGIQHLPIAYKAQGNAWVDKEIFSDWFHHIFVPSVREHFRTIGLPEDSKAILLLDH
SRAHSQESELVSENVFTIFLPSSVTSLLQPTEQGIRRAFMRLFINPPVAFQGFPTRHNIN
DAIVNVARAWNAVPSQVFQRAWRKLWPTVTFTEGSSSEEEAECCAIKPHKTFAHILGLVK
EGPTCSGSRLQDSRVEERVVAGRDIDEAPAIVAPSQATRCTKKSEKDTGETEEAAWEQAA
TSFEALVRFAERQPCFSVQEMGQLQALHTVFRRQQQLRQPRVALRAVIKLEALQEHPGVC
VATTHPTLPCSSTAGDN
NT seq 1674 nt   +upstreamnt  +downstreamnt
atggcctccaagcaggctgcagccaagggcaagggggagaagcggaagcgagtggtgcta
accctgaaggaaaagattgacatctgcacccggctggagcgtggggagagtaggaaggct
ctgatgcaggagtataatgtgggcatgtctactctgtatgacatcaaagcccacaaggcc
cagctcctcaggttcttcgccagctcagactctcggcaggcgctggaacagcgacgtacc
ctgcacaccccaaagctggagcacctggaccgggtgctctatgagtggttcctggtaaag
cgcgctgagggcatccctgtgtcgggccctatgctcatcgaaaaggccaaggacttctac
aagcagatgcggctgacagagccctgtgtgttctctggagggtggctttggcgcttcaag
gccaggcatggcattaaaaagctggatgcctccagcgagaagcaggcggctgaccaccaa
gctgctgagcagttctgtggctttttcaggagccttgcagcggagcacgggctgtctcca
gagcaggtgtacagcgctgatgagactggtcttgtctggcggtgcttgccaaattctgcc
ccagatgatgggactgtgccccacttcaaacagggcaaggacaggctgactgtcttgatg
tgcgctaatgccacaggctcccacagaatcaagcctttggccattgggaagggtggcggc
cccagagccttcagaggcatccagcacctgcctattgcttacaaggcccagggtaatgcc
tgggtagacaaggagattttctcagactggttccatcatatttttgtcccctcggtgaga
gagcactttagaaccataggcttaccagaagacagcaaggcaattctcttgctggaccat
tcccgggcccactcacaggagtctgagctagtgtcagagaacgtcttcaccatcttcctg
ccctccagcgtgacctccttactgcagcccacagaacaaggcattcgcagagccttcatg
aggctctttattaaccctcccgtggccttccagggcttccccacccgccacaacataaat
gacgccatagtcaacgtggcccgtgcctggaatgctgtgcctagccaggtcttccagcgg
gcctggaggaaactgtggcccactgtcacgttcactgaaggctcctcctctgaggaggaa
gcagagtgctgtgccatcaagcctcacaagacgttcgcacacatccttgggcttgtaaaa
gaagggccaacctgttctggcagcaggcttcaggacagcagggttgaagagcgggttgtg
gcagggagggacatagatgaggcccctgccattgtggcaccatcccaggccactaggtgt
acaaaaaagtcagagaaagataccggtgagactgaggaggcagcctgggagcaggcagcc
acatcctttgaggcacttgtgcgctttgcagagcggcagccgtgtttcagcgtgcaagag
atggggcagctgcaggcactgcacacggtgttcaggagacagcagcagctgaggcagccc
cgtgtggctctcagggctgtgatcaaacttgaggcccttcaggagcaccctggggtgtgt
gtggccacaacccaccctaccttgccttgctcttccactgcaggtgacaactaa

DBGET integrated database retrieval system