KEGG   Mus musculus (mouse): 16477
Entry
16477             CDS       T01002                                 

Symbol
Junb
Name
(RefSeq) jun B proto-oncogene
  KO
K09028  transcription factor jun-B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04668  TNF signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    16477 (Junb)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    16477 (Junb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16477 (Junb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16477 (Junb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    16477 (Junb)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB MAD DUF737
Other DBs
NCBI-GeneID: 16477
NCBI-ProteinID: NP_032442
MGI: 96647
Ensembl: ENSMUSG00000052837
Vega: OTTMUSG00000061397
UniProt: P09450 Q569U6
Position
8 C3; 8 41.41 cM
AA seq 344 aa
MCTKMEQPFYHDDSYAAAGYGRSPGSLSLHDYKLLKPTLALNLADPYRGLKGPGARGPGP
EGSGAGSYFSGQGSDTGASLKLASTELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
TGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPQAGPGGVYAGPEPPPVYT
NLSSYSPASAPSGGSGTAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLSRGASAFKEEP
QTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTL
KAENAGLSSAAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtgcacgaaaatggaacagcctttctatcacgacgactcttacgcagcggcgggatac
ggtcggagccctggcagcctgtctctacacgactacaaactcctgaaacccaccttggcg
ctcaacctggcggatccctatcggggtctcaagggtcctggggcgcggggtccaggcccg
gagggcagtggggcaggcagctacttttcgggtcagggatcagacacaggcgcatctctg
aagctagcctccacggaactggagcgcttgatcgtccccaacagcaacggcgtgatcacg
acgacgcccacgcctccgggacagtacttttacccccgtgggggtggcagcggtggaggt
acagggggcggcgtcaccgaggagcaggagggctttgcggacggttttgtcaaagccctg
gacgacctgcacaagatgaaccacgtgacgccccccaacgtgtccctgggcgccagcggg
ggtccccaggccggcccagggggcgtctatgctggtccggagccgcctcccgtctacacc
aacctcagcagttactccccagcctctgcaccctctggaggctccgggaccgccgtcggg
actgggagctcatacccgacggccaccatcagctacctcccacatgcaccaccctttgcg
ggcggccacccggcacagctgggcttgagtcgcggcgcttccgcctttaaagaggaaccg
cagaccgtaccggaggcacgcagccgcgacgccacgccgcctgtgtcccccatcaacatg
gaagaccaggagcgcatcaaagtggagcgaaagcggctgcggaacaggctggcggccacc
aagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtgaagacactc
aaggctgagaacgcggggctgtcgagtgctgccggtctcctacgggagcaagtggcgcag
ctcaagcagaaggtcatgacccatgtcagcaacggctgccagttgctgctaggggtcaag
ggacacgccttctga

DBGET integrated database retrieval system