KEGG   Mus musculus (mouse): 16485Help
Entry
16485             CDS       T01002                                 

Gene name
Kcna1, AI840627, Kca1-1, Kv1.1, MBK1, Mk-1, Shak, mceph
Definition
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 1
  KO
K04874  potassium voltage-gated channel Shaker-related subfamily A member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16485 (Kcna1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16485 (Kcna1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 16485
NCBI-ProteinID: NP_034725
MGI: 96654
Ensembl: ENSMUSG00000047976
Vega: OTTMUSG00000056736
UniProt: P16388
Position
6 F3; 6 61.57 cM
AA seq 495 aa AA seqDB search
MTVMSGENADEASTAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPN
TLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFY
ELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESSGPARVIAIVSVMVILIS
IVIFCLETLPELKDDKDFTGTIHRIDNTTVIYTSNIFTDPFFIVETLCIIWFSFELVVRF
FACPSKTDFFKNIMNFIDIVAIIPYFITLGTEIAEQEGNQKGEQATSLAILRVIRLVRVF
RIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEAEEAESHFSSIP
DAFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETE
GEEQAQLLHVSSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGNCTT
ADQNCVNKSKLLTDV
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgatgtcgggggagaatgcggacgaggcttcgaccgctccaggtcacccccag
gatggcagctacccgaggcaggcggaccacgacgaccacgaatgctgcgagcgcgtagta
atcaacatctccgggctgcgcttcgaaacgcagctcaagactctggcacagttccccaac
acgctgctgggcaacccgaagaaacgcatgcgctactttgaccccctgaggaacgagtac
ttctttgaccgcaaccggcccagcttcgatgccatcctttattactaccagtccgggggc
cgcctgcgcaggccggtcaacgtgcccctggacatgttctccgaggagattaaattttac
gagttgggcgaggaagccatggagaagttccgggaagatgagggcttcatcaaggaagag
gagcgccccctacccgagaaggagtaccagcgccaggtgtggctgctctttgagtatccg
gagagctcaggacctgcccgggttattgccattgtgtcggtcatggtcatcctcatctcc
atagtcatcttttgcctggagactctccctgagctgaaggacgacaaggacttcacgggc
accatccaccgcatcgacaacaccacagtcatctatacttccaacatcttcacagaccct
ttcttcattgtggaaaccttgtgtatcatctggttctcttttgagctggtggtgcgcttc
ttcgcctgccccagcaagacagacttctttaagaacatcatgaacttcatcgacattgtg
gccatcatcccttatttcattaccctgggcacggagatagctgagcaggagggaaatcag
aagggcgagcaggccacttccctggccatcctcagggtcatccgcttggtaagggtgttc
agaatcttcaaactctcccgccactccaagggccttcagatcctgggccagaccctcaaa
gctagtatgagggagttagggctgctcatctttttcctcttcattggggtcatactgttt
tctagcgcagtgtactttgcggaggcggaagaagctgagtcgcacttctccagtatcccc
gatgctttctggtgggcggtggtgtccatgaccactgtgggatacggtgacatgtaccct
gtgacaattggaggcaagatcgtgggctccttgtgtgccatcgctggtgtgctgacaatt
gccctgcccgtacctgtcattgtgtccaatttcaactatttctaccaccgagaaactgag
ggggaagagcaggctcagttgctccatgttagttctcctaacttagcctctgacagtgac
ctcagccgccgcagctcctctactatcagcaagtctgagtacatggagatcgaagaggat
atgaacaatagcatagcccattacagacaggctaatatcagaactggtaactgcaccaca
gctgatcaaaactgcgttaataagagcaagctcctgaccgatgtttaa

DBGET integrated database retrieval system