KEGG   Mus musculus (mouse): 16492
Entry
16492             CDS       T01002                                 

Symbol
Kcna4, Kv1., Kv1.4
Name
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 4
  KO
K04877  potassium voltage-gated channel Shaker-related subfamily A member 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    16492 (Kcna4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    16492 (Kcna4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16492 (Kcna4)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16492 (Kcna4)
SSDB
Motif
Pfam: Ion_trans K_channel_TID BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 16492
NCBI-ProteinID: NP_067250
MGI: 96661
Ensembl: ENSMUSG00000042604
Vega: OTTMUSG00000015041
UniProt: Q61423
Position
2 E3; 2 56.12 cM
AA seq 654 aa
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGTGGSGGG
PHHHHQTRGAYSSHDPQGSRGSRRRRRQRTEKKKLHHRQSSFPHCSDLMPSGSEEKILRE
LSEEEEDEEEEEEEEEEGRFYYSEEDHGDGCSYTDLLPQDDGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSRLLNDTSAPHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCGKEEKCQGKGDESETDKNNCSNAKAVETDV
NT seq 1965 nt   +upstreamnt  +downstreamnt
atggaagtggcgatggtgagtgccgagagctcagggtgcaacagccatatgccttatggt
tatgcagcccaggccagggcccgagagcgggagagactcgctcactccagggcagctgca
gctgctgctgtcgcagctgccacggctgctgtcgaaggcactgggggttctggtggaggc
ccccaccaccatcatcagacacgtggggcctactcctcccatgatcctcaaggtagccgt
ggaagtagaaggaggaggcgtcagcgaactgagaagaagaaactccaccacaggcagagc
agttttcctcattgctcagacctgatgcccagtggctctgaagagaagatcctgagggag
ctaagcgaggaagaggaagacgaggaggaggaagaggaggaggaggaggagggaaggttt
tactatagtgaagaagaccatggggatgggtgttcgtacacagacctgctgccacaggat
gatgggggtggtggcggctacagttcagtccgctatagtgactgctgtgaacgtgtggtg
ataaatgtgtctggtctacgcttcgaaacccaaatgaaaactttggcccagtttccagaa
actctgttgggagaccctgagaagaggactcagtacttcgaccctttgcgcaatgagtat
ttttttgatcggaaccgacccagctttgatgccattttgtattattaccagtcaggaggc
cgcctgaagagaccagtcaatgtcccctttgatatcttcaccgaggaggtgaagttctat
cagttgggagaggaagccctgctcaagttccgggaggatgagggctttgtgagagaagag
gaggacagggctctgccagaaaatgaatttaaaaaacagatttggcttctctttgaatat
ccagagagttctagccctgccaggggtatagccattgtgtctgtcctggtcatcttaatc
tctattgtcatattttgcctggaaaccttgccggagttcagggatgatagggaccttatt
atggccctcagtgcaggcgggcacagcagattgctgaatgacacctcggcaccccacctg
gagaactcagggcacacaatattcaatgaccctttcttcatcgtggagacagtgtgtatt
gtgtggttttcctttgagtttgtggttcgatgctttgcttgtcccagccaagcactcttc
ttcaaaaacatcatgaacatcattgatatcgtctccattttgccttacttcatcactctg
ggcactgacctggcccaacagcaggggggtggcaatggccagcagcagcaggccatgtcc
tttgccatccttaggatcattcgtctggtccgagtattccggatcttcaagctctccaga
cactccaaaggcctgcagatcctgggccacaccctaagagccagcatgcgggaactgggc
cttcttatctttttcctcttcatcggggttatcctcttttccagcgctgtgtattttgca
gaggcggatgaacccactacccatttccaaagcattccagatgcgttttggtgggctgtg
gtaaccatgacaactgtgggctatggggacatgaagcccatcacagtcgggggaaagatt
gtggggtccctgtgtgccattgcgggtgtcttaaccattgctttgcctgtgccggtgatt
gtgtctaactttaactatttctaccacagagagactgaaaatgaagaacagacccagctg
acacaaaacgcagtcagttgtccatacctaccttctaatttgctcaagaaatttcggagc
tccacttcttcttccctgggggacaagtcagagtatctagagatggaagaaggggtcaag
gaatcattatgtggaaaggaggagaagtgtcagggaaagggagatgagagcgagacagat
aaaaacaactgttctaatgcaaaggctgtggagactgatgtgtga

DBGET integrated database retrieval system