KEGG   Mus musculus (mouse): 16493
Entry
16493             CDS       T01002                                 

Symbol
Kcna5, Kv1.5
Name
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 5
  KO
K04878  potassium voltage-gated channel Shaker-related subfamily A member 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16493 (Kcna5)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16493 (Kcna5)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel DctQ
Other DBs
NCBI-GeneID: 16493
NCBI-ProteinID: NP_666095
MGI: 96662
Ensembl: ENSMUSG00000045534
Vega: OTTMUSG00000056734
UniProt: Q61762
Position
6 F3; 6 61.35 cM
AA seq 602 aa
MEISLVPMENGSAMTLRGGGEAGASCVQSPRGECGCPPTAGLNNQSKETSPRRRATHEDA
GQGGRPLPPMPQELPQPRRPSAEDEEGEGDPGLGTVEEDQAPQDSGSLHHQRVLINISGL
RFETQLGTLAQFPNTLLGDPVKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPV
NVSLDVFADEIRFYQLGDEAMERFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSA
RAIAIVSVLVILISIITFCLETLPEFRDERELLRHPPVPPQPPAPAPGANGSGSGVLSSG
PTVAPLLPRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDIVAIFPYF
ITLGTELAEQQPGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASM
RELGLLIFFLFIGVILFSSAVYFAEADNQGSHFSSIPDAFWWAVVTMTTVGYGDMRPITV
GGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDHEEQAALKEEQGIQRRESGLDTG
GQRKVSCSKASFCKTGGPLESTDSIRRGSCPLEKCHLKAKSNVDLRRSLYALCLDTSRET
DL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggagatctccctggtgcccatggagaacggcagtgccatgaccctcagaggaggaggg
gaggcaggggcaagctgtgtgcagagccccaggggagagtgtgggtgccctccgacggct
ggactcaataatcagtccaaagaaacatcaccgaggaggcgcgccacacacgaggatgcg
ggccagggtgggaggcctttgccccctatgcctcaggagctgccacagcctagaaggcca
tctgctgaggatgaggagggagaaggcgaccctggcctgggcacagtggaggaggaccag
gctcctcaggactcaggatcactccatcaccagcgggtcctcataaacatctcgggtttg
cgctttgagacgcagctgggcaccctggcgcagtttcccaacaccctcctgggggaccca
gtcaaacgcctgcgctacttcgatcccttgagaaatgagtacttcttcgaccgcaaccgg
cctagcttcgatggcattttgtactactaccagtctgggggccgcctgcgcaggccggtc
aatgtctccctggatgtgtttgcagatgagatccgcttttaccagctgggggacgaggcc
atggagcgcttccgggaggatgaaggcttcatcaaggaagaggagaagcccctgccccgc
aatgagttccagcgccaggtgtggcttatcttcgaatacccagaaagctctgggtcagca
agagccattgccatcgtgtcggtcttggtcattctcatctctatcatcaccttctgcttg
gagactctgcctgagttcagggatgaacgggagctgttacgccaccccccagtgccgccg
cagcccccagcccctgccccaggggcaaatggcagtggctctggtgtcctttcctctggc
cccacagtggctccgctcctgcctaggacactggctgacccattcttcatcgtggagacc
acatgtgtgatctggttcacttttgagctgcttgtgcgtttctttgcttgccccagcaag
gcagaattctctcggaatattatgaacatcattgatattgtggccatcttcccctacttt
atcaccctgggcaccgagctggcagagcaacaaccagggggtggtggtcagaatgggcag
caggccatgtccctagccatcctcagggtgatccgcctggtccgggtgttccgaatcttc
aagctctcccgccactccaagggactgcagatcctgggtaagaccttacaggcgtccatg
cgggagctcgggctgctcatcttcttcctcttcatcggagtcatcctcttctccagcgct
gtctacttcgcagaggcagacaatcaggggtcgcacttctccagtatcccggatgcattc
tggtgggcagtagtcactatgaccactgtaggctacggggacatgaggcccatcactgta
gggggcaagattgtgggctcactgtgcgccatagctggggtcctcaccattgctctgcct
gtgcccgtcatcgtctccaattttaattacttctatcatcgggagacagaccacgaggag
caggctgccctgaaggaagagcaaggcatccagaggcgggagtctgggctggacacagga
ggtcaacggaaggtcagctgcagcaaggcctccttctgcaagactgggggacccctggag
agtactgacagtatcagaaggggtagctgtcctctagaaaagtgtcacctaaaggccaag
agcaacgtggacctgcgaaggtctctgtatgccctctgtctggacactagccgggaaaca
gatttgtaa

DBGET integrated database retrieval system