KEGG   Mus musculus (house mouse): 16495
Entry
16495             CDS       T01002                                 
Symbol
Kcna7, Kv1.7
Name
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, member 7
  KO
K04880  potassium voltage-gated channel Shaker-related subfamily A member 7
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16495 (Kcna7)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16495 (Kcna7)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel DUF423
Other DBs
NCBI-GeneID: 16495
NCBI-ProteinID: NP_034726
MGI: 96664
Ensembl: ENSMUSG00000038201
UniProt: Q17ST2
Position
7:45055384..45060806
AA seq 489 aa
MLFLPADTGHPTGVAAASGPHVRSPVARAVRAMEPRCPPPCGCCERLVLNVAGLRFETRA
RTLGRFPDTLLGDPVRRSRFYDGARREYFFDRHRPSFDAVLYYYQSGGRLRRPAHVPLDV
FLEEVSFYGLGAAALARLREDEGCAVPPERPLPRRAFARQLWLLFEFPESSQAARVLAVV
SVLVILVSIVVFCLETLPDFRDDRDDPGLAPVAAATGPFLARLNGSSPMPGAPPRQPFND
PFFVVETLCICWFSFELLVRLVACPSKAVFFKNVMNLIDFVAILPYFVALGTELARQRGV
GQPAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFS
SAVYFAEVDRVDTHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTIS
LPVPVIVSNFSYFYHRETEGEEAGMYSHVDTQPCGTLEGKANGGLVDSEVPELLPPLWPP
AGKHMVTEV
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgctatttttacccgccgacaccggacacccgactggggtggctgcggcgtcggggcca
cacgtccgttcaccggtcgcccgggctgtgcgcgccatggagccacggtgcccgccgccc
tgcggctgctgcgagcggctggtgctcaacgtggccgggttgcgcttcgagacccgcgcg
cgcacgctcggccgcttcccggacacgctgctgggggacccggtgcgccgcagccgcttc
tacgacggcgcgcgccgcgagtatttcttcgaccgacaccggcccagcttcgatgcggtg
ctctactactaccagtcgggcggccggctgagacggccggcgcacgtgcccctcgacgtc
ttcctggaggaggtgtccttctacgggctgggcgcggcggcgctggcgcggctgcgggag
gacgagggctgcgcggtgccgcccgagcggccgctgccccgccgcgcctttgcgcgtcag
ctctggctgctcttcgaatttcctgagagctcgcaggctgcgcgcgtgctcgccgtggtc
tccgtactcgtcatcctggtctccatcgtggtcttttgcctcgagacactgccagacttc
cgcgacgaccgcgatgacccggggctcgcgcccgtagccgctgctactggcccgttcctc
gcccgactgaatggctccagtcccatgccaggagcccctccccgacagcccttcaacgat
ccattctttgtggtggagaccctgtgtatctgctggttctcctttgagctgctggtgcgt
ctggtggcctgccctagcaaagctgtgttcttcaagaatgtgatgaacctaattgacttc
gtggccatcctgccttacttcgtggccctgggcacggagttagcccggcagcggggtgtg
ggccagccggctatgtccctggccatcctaagggtcatccgattggtgcgtgtcttccgc
atcttcaagctctccaggcattcgaagggtctacagatcttgggtcagacactgcgggct
tccatgcgtgagctaggtctcctcatcttcttcctcttcattggcgtggtcctcttttcc
agcgcagtctactttgctgaagtggaccgggtggacacccatttcaccagcatcccggag
tccttttggtgggcagtggtcaccatgaccacggttggctatggggacatggcacccgtc
accgtgggtggcaagatcgtgggctctctgtgtgccattgcaggtgtgctcaccatctct
ctgcctgtgcctgtcattgtctctaactttagctacttttaccaccgggagacagagggc
gaagaggcagggatgtacagccatgtggacacacagccctgcggtaccctggagggcaag
gctaatggggggctggtggactctgaggtgcctgaactcctcccaccactctggccccct
gcagggaaacacatggtgactgaggtgtga

DBGET integrated database retrieval system