KEGG   Mus musculus (mouse): 16497
Entry
16497             CDS       T01002                                 

Symbol
Kcnab1, Akr8a8, Kvbeta1.1, mKv(beta)1
Name
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, beta member 1
  KO
K04882  potassium voltage-gated channel Shaker-related subfamily A, beta member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16497 (Kcnab1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16497 (Kcnab1)
SSDB
Motif
Pfam: Aldo_ket_red MYRF_ICA
Other DBs
NCBI-GeneID: 16497
NCBI-ProteinID: NP_034727
MGI: 109155
Ensembl: ENSMUSG00000027827
Vega: OTTMUSG00000034877
UniProt: P63143
Position
3:64856633..65285646
AA seq 401 aa
MQVSIACTEHNLKSRNGEDRLLSKQSSNAPNVVNAARAKFRTVAIIARSLGTFTPQHHIS
LKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDT
AEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQR
LQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFN
MIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRAS
LKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSST
PEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcaagtctccatagcctgcacagagcacaatttgaagagtcgaaatggtgaggaccga
cttctgagcaagcagagctccaacgcccccaatgtggtgaacgcagcccgggccaaattc
cgcactgtcgctatcatcgctcgcagcctggggaccttcacccctcagcatcacatttct
ctcaaagagtccaccgcaaagcagactggcatgaaatataggaatcttgggaaatcagga
ctcagagtttcatgcttgggtcttggaacatgggtgacatttggaggtcaaatctcagat
gaggttgctgaacggctgatgacaattgcctacgaaagtggagttaatctcttcgacaca
gctgaggtctatgctgctgggaaggctgaggtgattctgggaagcatcatcaagaagaaa
ggctggaggaggtccagcttggtcatcacaaccaaactctactggggtggaaaagctgag
acagaaaggggactgtcaagaaagcacatcattgaaggactgaaaggctccctccagagg
ctgcaactggaatacgtggatgtggtctttgcaaatcgcccagacagcaacactcccatg
gaagaaatcgttcgagccatgacgcacgtgatcaaccaaggcatggccatgtactggggc
acctcgaggtggagcgcgatggagatcatggaagcctactctgtcgcacggcagttcaac
atgatcccgcctgtctgtgagcaagctgagtaccatcttttccagagagagaaggtggag
gtccagctgccggagctctaccataaaataggagttggtgcaatgacatggtctccactt
gcttgtggaattatttcaggaaaatatggaaatggggtgccagaaagttctagagcttca
ctgaagtgctaccagtggttgaaggaaagaatcgtaagtgaagaagggagaaaacagcaa
aacaagctgaaagacctctctccaatcgctgagcgcctggggtgcacgctacctcagctg
gctgtggcgtggtgcctgagaaatgagggtgtgagttctgtgctcctgggatcatccact
ccggaacaactcattgaaaaccttggtgccattcaggtcctccctaagatgacatctcac
gtggtgaacgagattgataacatactgcgcaacaagccctacagcaaaaaggactataga
tcataa

DBGET integrated database retrieval system