KEGG   Mus musculus (mouse): 16498
Entry
16498             CDS       T01002                                 

Gene name
Kcnab2, F5, I2rf5, Kcnb3, kv-beta-2
Definition
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, beta member 2
  KO
K04883  potassium voltage-gated channel Shaker-related subfamily A, beta member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16498 (Kcnab2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16498 (Kcnab2)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 16498
NCBI-ProteinID: NP_001239585
MGI: 109239
Ensembl: ENSMUSG00000028931
Vega: OTTMUSG00000033817
UniProt: P62482
Position
4 E2; 4 83.08 cM
AA seq 367 aa
MYPESTTGSPARLSLRQTGSPGMIYSTRYGSPKRQLQFYRNLGKSGLRVSCLGLGTWVTF
GGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIF
WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQG
MAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQAEYHMFQREKVEVQLPELFHKIGVGA
MTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLG
CTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSIVHEIDSILGNKPY
SKKDYRS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgtatccggaatcaaccacggggtccccagctcgactctccctgcggcagacaggctcc
cccgggatgatctacagtactcgttatgggagtcccaaaagacagctccagttttacagg
aatctgggcaaatctggccttcgggtctcctgcctggggcttggaacatgggtgaccttc
gggggccagatcacggatgagatggcagagcacctaatgaccttggcctacgataatggc
atcaacctgttcgatacggcggaggtctacgctgctggaaaagctgaagtggtattaggg
aacatcattaagaagaagggatggagacggtccagccttgtcatcaccaccaagatcttc
tggggtggaaaagcggagactgagagaggcctttccaggaagcacataattgaaggactg
aaagcgtccctggagcggctgcagctggagtacgtggatgtggtttttgccaaccgccca
gaccccaacacgcccatggaagagaccgtgcgggccatgacccatgtcatcaaccagggg
atggccatgtactggggcacatcacgctggagctccatggagatcatggaggcctactcg
gtggctcggcagttcaacctgatcccgcccatctgcgagcaagcggaatatcacatgttc
cagagggagaaggtggaggtccagctgccagagctgttccacaagataggagtaggtgcc
atgacctggtcccctctggcgtgcggcatcgtctcagggaagtatgacagcgggatccca
ccctactccagagcctccctgaagggctaccagtggttgaaggacaagatcctgagtgag
gagggtcgccgccagcaggccaagctgaaggaactgcaggccattgccgaacgcctgggc
tgcaccctaccccagctggccatagcctggtgcctgaggaatgagggtgtcagctccgtg
cttctgggtgcttccaatgcagaacaacttatggagaacattggagcaatacaggtcctt
ccaaaattgtcgtcttccatcgtccacgagatcgacagcattctgggcaataaaccctac
agcaaaaaggactatagatcctaa

DBGET integrated database retrieval system