KEGG   Mus musculus (mouse): 16499
Entry
16499             CDS       T01002                                 

Gene name
Kcnab3, C330022D06Rik, Kcna, Kcnab4, mKv(beta, mKv(beta)4
Definition
(RefSeq) potassium voltage-gated channel, shaker-related subfamily, beta member 3
  KO
K04884  potassium voltage-gated channel Shaker-related subfamily A, beta member 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16499 (Kcnab3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16499 (Kcnab3)
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 16499
NCBI-ProteinID: NP_034729
MGI: 1336208
Ensembl: ENSMUSG00000018470
Vega: OTTMUSG00000005965
UniProt: Q8VD73 Q8C7S9 Q8C439
Position
11; 11 B3
AA seq 404 aa
MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPVGGGHGNPPGGGGPSSKSRAAVVPR
PPAPAGALRESTGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDLLTVAYEH
GVNLFDTAEVYAAGKAERTLGNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEG
LQGSLDRLQLEYVDIVFANRSDPNSPMEEIVRAMTYVINQGLALYWGTSRWSAAEIMEAY
SMARQFNLIPPVCEQAENHFFQREKVEMQLPELYHKIGVGSVTWSPLACGLITSKYDGRV
PDTCKATVKGYQWLKEKVQSEEGKKQQARVMDLLPTARQLGCTVAQLAIAWCLRSEGVSS
VLLGVSSAEQLMEHLGSLQVLSQLTPQTVVEIDALLGNKSHSKK
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcaggtgtctatcgcgtgtaccgagcagaaccttcgcagccggagcagtgaggaccgt
ctctgtggaccccggcccggtcctgggggcggtaatggagggccagtgggcggagggcat
gggaaccctccggggggtggaggaccgagctcgaagtcacgagctgcagtggtccctaga
cccccagcacctgctggggcccttcgagagagcaccggccgaggcactggcatgaaatac
aggaacctagggaagtctgggctccgggtgtcctgtcttggccttggtacctgggtcacg
tttggctctcagatctcagatgagacagcagaagatctcctgacagttgcctatgagcac
ggcgtaaacctgtttgacactgctgaagtgtacgcggcaggaaaggctgaaagaaccctt
ggcaatattctcaagagcaaaggctggaggagatcaagctatgttatcaccaccaagatt
ttttggggtggacaggcagaaacagagcgtggcttgagtcgcaaacacatcattgaaggc
ttgcaaggatccctggaccgcctccagctggaatacgttgatatagtatttgccaatcgt
tcagatcctaatagtcctatggaggagattgtgagagccatgacctatgtcatcaaccag
ggcctggccctatactgggggacatccagatggagtgctgcagaaatcatggaggcctac
tccatggccagacagttcaatctgatccctcctgtgtgcgagcaagcggagaaccacttc
tttcagagggagaaggtggagatgcagctgcctgagctctaccacaaaattggtgttggc
tcagtcacttggtcccccctggcgtgcggcctcattactagcaagtatgatgggcgagtt
ccggatacttgcaaagccactgtcaagggctaccagtggctcaaagaaaaagttcagagt
gaggaaggcaagaagcaacaagccagagtgatggatcttctcccaactgctcgccagcta
ggctgcaccgtggcccaactagctatagcctggtgtctccgaagcgagggtgtcagctct
gttttactgggggtgtccagtgcagagcagctgatggaacatctgggctccctacaggtg
ctgagtcagctgacgccgcaaacggtggtggaaatagatgcgctcttggggaacaaatcg
cattccaagaagtag

DBGET integrated database retrieval system