KEGG   Mus musculus (house mouse): 16500
Entry
16500             CDS       T01002                                 
Symbol
Kcnb1, Kcr1-1, Kv2.1, Shab
Name
(RefSeq) potassium voltage gated channel, Shab-related subfamily, member 1
  KO
K04885  potassium voltage-gated channel Shab-related subfamily B member 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16500 (Kcnb1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16500 (Kcnb1)
SSDB
Motif
Pfam: Kv2channel Ion_trans BTB_2 Ion_trans_2 DUF4790 DUF5843
Other DBs
NCBI-GeneID: 16500
NCBI-ProteinID: NP_032446
MGI: 96666
Ensembl: ENSMUSG00000050556
Vega: OTTMUSG00000001150
UniProt: Q03717
Position
2:complement(166937889..167032088)
AA seq 857 aa
MPAGMTKHGSRSTSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKL
RDCNTHDSLLQVCDDYSLEDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALSFSQELD
YWGIDEIYLESCCQARYHQKKEQMNEELKREAETLREREGEEFDNTCCAEKRKKLWDLLE
KPNSSVAAKILAIISIMFIVLSTIALSLNTLPELQSLDEFGQSTDNPQLAHVEAVCIAWF
TMEYLLRFLSSPKKWKFFKGPLNAIDLLAILPYYVTIFLTESNKSVLQFQNVRRVVQIFR
IMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSSLVFFAEKDEDDTK
FKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIVNNFSEFY
KEQKRQEKAIKRREALERAKRNGSIVSMNMKDAFARSIEMMDIVVEKNGEGVAKKDKVQD
NHLSPNKWKWTKRALSETSSSKSFETKEQGSPEKARSSSSPQHLNVQQLQDMYSKMAKTQ
SQPILNTKEMAPQSQPQEELEMGSMPSPVAPLPTRTEGVIDMRSMSSIDSFISCATDFPE
ATRFSHSPLASLSGKSGGSTAPEVGWRGALGASGGRLMETNPIPEASRSGFFVESPRSSM
KTHNPMKLRALKVNFLEGDPTPLLPALGLYHDPLRNRGGAAAAVAGLECASLLDKPVLSP
ESSIYTTASARTPPRSPEKHTAIAFNFEAGVHQYIDTDTDDEGQLLYSVDSSPPKSLHGS
TSPKFSLGARTEKNHFESSPLPTSPKFLRPNCVYASEGLPGKGPGAQEKCKLENHTSPDV
HMLPGGGAHGSTRDQSI
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgccggcgggcatgacgaagcatggctcgcgctccaccagctcgctgccgcccgagccc
atggagatcgtgcgcagcaaggcgtgctcgcgccgggtgcgcctcaacgtcgggggcctg
gcgcacgaggtgctgtggcgcactctggaccgcctgcctcgcacgcggctgggcaagctc
cgggactgcaacacgcacgactctctgctccaggtgtgcgacgactacagcctcgaggac
aacgagtacttcttcgaccgccaccctggcgccttcacctctattctcaatttctaccgc
accggccggctgcacatgatggaggagatgtgcgcgctgagcttcagccaggagctggac
tactggggcatcgatgagatctacctggagtcctgctgccaggcccgctaccaccaaaag
aaggagcagatgaacgaggagctgaagcgggaggctgagacgctgcgggagcgggagggc
gaggagttcgacaacacgtgctgtgctgagaagaggaagaaactttgggacctgctggag
aagcccaactcatcggtggccgccaagatcctggccatcatctccatcatgttcattgtc
ctctccaccattgccctgtcactcaacacactgcctgagctacagagcctggacgaattc
ggccagagcacggacaacccgcagctggcacacgtggaggctgtgtgcatcgcgtggttc
accatggagtacttgctgaggttcctgtcctcgcccaagaaatggaagttctttaagggc
cccctcaacgccattgacttactggccatcctgccctactacgtcaccatcttcctcaca
gaatccaacaagagcgtgctgcagttccagaatgtgcgccgtgtggtccagatcttccgc
atcatgcgcatcctgcgcatcctgaagttggcccgccactccaccggtctgcagtccttg
ggcttcacgctgcgcaggagctacaacgagctgggcttgctcatcctcttcctcgccatg
ggcatcatgatcttctccagcctggtcttctttgccgagaaggatgaggatgacaccaag
ttcaaaagcatccccgcctctttctggtgggctaccatcaccatgacgaccgttggttac
ggagacatctaccctaagactctcctggggaaaatcgtggggggcctctgttgcattgcc
ggtgtcctggtgattgccctccccattccaattatcgtcaataacttctccgagttctac
aaggagcagaagcgccaggagaaagccatcaagcggagagaggctctggagagagccaag
aggaacggcagcatcgtgtccatgaacatgaaggatgccttcgcccggagcatcgagatg
atggacatcgtggtggagaaaaatggagagggcgtggctaagaaggacaaggtgcaggat
aaccacctgtctcccaacaagtggaaatggaccaagagggcgctctccgagaccagctcg
agcaagtcctttgaaaccaaggagcagggatctcctgagaaggccaggtcctcgtctagt
ccgcagcacttgaacgtccagcagctgcaagacatgtacagcaagatggccaagacccag
tctcaacccatcctcaacaccaaggagatggcgccgcagagccagccgcaggaagaactg
gagatgggcagcatgcccagccccgtggcccctctgcccacgcgcacagagggcgtcatc
gacatgcgcagcatgtctagcatcgacagcttcatcagctgcgccacggacttccctgaa
gccaccagattctcccacagtcctctggcatccctctccggcaagtctgggggcagcaca
gccccggaggtgggctggcggggggctctgggtgccagcggcgggagactcatggagacc
aaccccatccccgaggccagccgctctggtttcttcgtggagagcccccggagttccatg
aagacccacaaccccatgaagctgcgagcgctcaaggttaacttcctggagggcgatccc
accccgctgctaccggctctgggcttgtatcacgatcctcttaggaacagaggaggcgca
gcggctgcagtcgccggactggagtgtgcctccctcttagacaagcccgtgctgagcccg
gagtcctccatctacaccacagcaagtgccaggacgccccctcgctccccagagaaacac
acagcaatagcgttcaacttcgaggcgggggtccaccagtacatagacaccgacactgat
gacgagggtcagctgctctacagcgtggactccagtcctcccaagagtctccacgggagt
accagccccaagttcagccttggagctagaacagaaaagaaccacttcgagagctccccg
ttgcccacctcccctaagttcttaaggccgaactgtgtctacgcctcagaagggttacct
gggaaaggtcccggggcccaagagaaatgcaagctggagaaccacacctcccccgatgtg
cacatgctgcctgggggaggagcacacgggagcactcgggatcagagtatctga

DBGET integrated database retrieval system