KEGG   Mus musculus (mouse): 16506
Entry
16506             CDS       T01002                                 

Symbol
Kcnd1, 1110037K09Rik, Kca2-1, Kv4.1, Shal, Shal1, mShal1
Name
(RefSeq) potassium voltage-gated channel, Shal-related family, member 1
  KO
K04891  potassium voltage-gated channel Shal-related subfamily D member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16506 (Kcnd1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16506 (Kcnd1)
SSDB
Motif
Pfam: Ion_trans BTB_2 DUF3399 Ion_trans_2 Shal-type BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 16506
NCBI-ProteinID: NP_032449
MGI: 96671
Ensembl: ENSMUSG00000009731
Vega: OTTMUSG00000017926
UniProt: Q03719 A2AEX0
Position
X:7686907..7704517
AA seq 651 aa
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPEVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDAESGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEQAGEGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGTPRWPSKEQSCGDRFPTAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNDDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTSKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGDGQMLCVRSRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSEALGAVSLGGRTSRSTSVSSQPMGPGSLFSSCCSRRVNRR
AIRLANSTASVSRGSMQELDTLAGLRRSPAPQTRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPSGGGGSGGTPNTTLRNSSLGTPCLLPETVKISSL
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggcaggtgtggccacatggctaccatttgcaagggccgcagcagtgggctggctg
cccttagcccagcagcccctaccccctgcaccggaggtgaaggcatcccgaggggatgag
gttctggtggtgaatgtgagtggtcggcgctttgagacctggaaaaacacactggatcgc
tacccagacacattgctgggcagctcggagaaggaattcttctatgatgctgaatctggc
gagtacttctttgatcgtgacccagacatgttccggcacgtgctgaacttttatcgcact
ggccggctgcactgccccaggcaggagtgcatccaggcctttgatgaggagctggccttc
tatggcttggtcccagagctggttggtgactgctgtcttgaagagtacagggaccgtaag
aaggaaaacgcagagcgcctggcagaagatgaggaggctgagcaggccggggaaggtcca
gcccttccagcaggcagctccctgcgacagcgactctggagggcctttgagaacccccac
acgagcactgcagccctggttttctactatgtgactggcttcttcatagctgtgtcagtc
attgccaacgtcgtggagaccatcccatgtcgtggtaccccacgatggccctccaaagag
cagtcgtgtggtgaccgcttccctacagcctttttctgtatggacacagcctgtgtactc
atattcacaggggagtacctgctgcggctcttcgcagcccccagccgttgtcgcttcctg
cggagtgtgatgagccttatcgatgtggtggccatcctaccctactatattgggctgttc
gtgcccaagaatgatgatgtctctggtgcctttgtcaccctccgtgtgttccgggtcttc
cgaatcttcaagttctccaggcactcgcagggcctgaggattctgggctacaccctcaag
agctgtgcctctgagctaggctttctcctcttttccctcaccatggccatcatcatcttt
gccactgtcatgttctatgctgagaagggcacgagcaagaccaacttcacaagcatccct
gctgccttctggtataccattgtcaccatgaccacacttgggtatggagatatggtacct
agcaccattgcaggcaaaatttttgggtccatctgctcacttagcggtgtcttggtcatt
gccttgcctgtgccagtcattgtatccaacttcagccgcatctaccaccagaaccagcgt
gctgacaagcgccgggcacagcagaaagtgcgcctggcaagaatccgtttggcaaagagt
ggtaccaccaatgccttcctgcagtataagcaaaatgggggcctcgaggacagtggcagt
ggcgacggacaaatgctgtgcgttaggagccgctctgcttttgaacaacagcatcaccat
ctgctgcattgtctggagaagactacgtgtcacgagttcacagacgagctaactttcagt
gaggcccttggagcagtctcactgggtggtcgcaccagccgcagtacctcagtatcatcc
caaccaatggggcctgggagcctgttctcatcctgctgctctcgaagggtcaatcgcaga
gccatccgccttgccaactctactgcctctgtcagccgtggcagcatgcaggagctagac
acactagcaggtcttcggaggagccctgcccctcaaacccgctcaagcctcaatgccaag
ccccacgacagccttgacctgaactgtgacagccgggacttcgtggccgccatcatcagt
atccccaccccccctgccaacacgccagatgaaagtcaaccttcctcccctagtggtggt
ggcggcagtggtggcacacccaacaccactctcaggaactccagcttgggtactccgtgc
ctcctccctgagactgtcaagatctcttccctgtga

DBGET integrated database retrieval system