KEGG   Mus musculus (mouse): 16508
Entry
16508             CDS       T01002                                 

Gene name
Kcnd2, AI839615, AW555701, Kv4., Kv4.2, R75121
Definition
(RefSeq) potassium voltage-gated channel, Shal-related family, member 2
  KO
K04892  potassium voltage-gated channel Shal-related subfamily D member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    16508 (Kcnd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16508 (Kcnd2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16508 (Kcnd2)
SSDB
Motif
Pfam: Ion_trans DUF3399 BTB_2 Ion_trans_2 Shal-type BTB_3 PKD_channel
Other DBs
NCBI-GeneID: 16508
NCBI-ProteinID: NP_062671
MGI: 102663
Ensembl: ENSMUSG00000060882
Vega: OTTMUSG00000036888
UniProt: Q9Z0V2
Position
6 A2- A3.1; 6 8.49 cM
AA seq 630 aa
MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE
RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA
FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTGESALPTMTARQRVWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF
TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA
FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHH
LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI
PNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI
PTPPVTTPEGDDRPESPEYSGGNIVRVSAL
NT seq 1893 nt   +upstreamnt  +downstreamnt
atggcagccggtgttgcagcatggctgccctttgccagggcagccgccattgggtggatg
cctgttgcttcggggcctatgcctgcgcccccaagacaggagagaaaaaggactcaggac
gctctgatagtgctgaacgtgagtggcacccgtttccagacatggcaagacaccctggaa
cgatacccagacactctgctgggtagttctgagagagactttttctaccacccagagacc
caacaatacttctttgaccgtgacccggacatcttccgccacatcctcaacttctaccgc
acggggaagcttcactatccccgccatgagtgcatctcggcttatgatgaagaactggcc
ttctttggcctcatcccagaaattattggcgactgctgttatgaggagtacaaggaccgc
aggcgggagaatgctgagcgcctccaggatgatgcagacactgacaatacaggagagagt
gcgctgcccaccatgactgctaggcagagggtctggcgggcctttgagaatccccacacc
agcaccatggccctggtgttctactatgtgactgggttcttcattgccgtctcagtcatc
gcgaatgtggtggaaacagttccatgtgggtctagcccaggccacataaaagaactgcct
tgtggggagaggtatgcggtggccttcttctgcttggataccgcctgtgtcatgatcttc
acagttgagtacttgcttcgcctggccgcagcacctagtcgttaccgtttcgtgcgcagt
gtcatgagtatcatcgacgtggtggccatcctaccctattacattgggctggtgatgaca
gacaatgaggatgtcagtggagcctttgtcacactccgagtctttcgagtcttcaggatc
tttaagttttcccgccactctcaagggctgcgtatactggggtacaccctgaagagctgt
gcatcagaactgggcttcttgctcttttctctcacaatggctatcatcattttcgctacc
gttatgttctacgcagagaagggctcttcagcaagcaagttcaccagcatcccggcagcc
ttctggtacaccatcgtcaccatgacaacactggggtatggcgacatggtaccaaaaacc
atagcagggaagatttttgggtccatctgctcactgagcggagtcttggtcattgcgcta
cccgtgcctgtgatcgtgtcgaacttcagtcggatctaccaccaaaaccaacgagcagac
aaacgaagggcacagaagaaagccaggctggccaggatccgagcagccaaaagcgggagt
gcaaatgcctacatgcagagcaagcggaatgggctactgagcaaccagctgcagtcctcg
gaggatgaaccggccttcataagcaaatctggatccagctttgagacacagcaccaccac
ctgcttcactgcctggagaaaaccacgaaccatgagtttgtcgatgaacaagtctttgaa
gaaagctgcatggaagttgccaccgtcaatcgcccatcaagtcacagtccctctctctcc
tcacaacaaggagtcaccagcacttgctgctcacggagacacaaaaagactttccgcatt
cctaatgccaatgtgtcgggaagccatagaggcagtgtgcaagaactcagtacaattcag
atcagatgtgtggagagaactccactatccaacagccgatccagcttaaatgccaaaatg
gaagagtgtgttaaactaaactgtgaacaaccttacgtgaccacagcaataataagcatc
ccaacacctccagtaaccaccccagaaggcgacgacaggcccgagtctcctgagtattcg
ggaggaaatatcgtcagggtgtctgccttgtaa

DBGET integrated database retrieval system