KEGG   Mus musculus (mouse): 16510Help
Entry
16510             CDS       T01002                                 

Gene name
Kcnh1, EAG1, Kv10.1, M-eag
Definition
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 1
  KO
K04904  potassium voltage-gated channel Eag-related subfamily H member 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16510 (Kcnh1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16510 (Kcnh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PAS_9 cNMP_binding Ion_trans_2 PAS PAS_3 PAS_4 Cupin_3 Cupin_2
Motif
Other DBs
NCBI-GeneID: 16510
NCBI-ProteinID: NP_034730
MGI: 1341721
Ensembl: ENSMUSG00000058248
Vega: OTTMUSG00000024518
UniProt: Q60603 Q3UHC9 A0A1L1M1J8
Structure
PDB: 

Position
1; 1 H6
AA seq 989 aa AA seqDB search
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNALTDHTSANH
SLVKASVVTVRESPATPVSFQAATTSTMSDHAKLHAPGSECLGPKAVSCDPAKRKGWARF
KDACGKGEDWNKVSKAESMETLPERTKAPGEATLKKTDSCDSGITKSDLRLDNVGETRSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVKYELKEDIKALNAKMTSIEKQLSEILRILMS
RGSAQSPQETGEISRPQSPESDRDIFGAS
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggctggcggccggcggggactagtggccccgcagaacacgtttctggagaac
atcgtgcggcggtccaacgacactaattttgtgttggggaatgcccagatagtcgactgg
cccatcgtgtacagcaatgatggattctgcaagctgtctggctaccaccgggcagaagtg
atgcagaaaagcagcgcctgcagttttatgtatggagagctgactgacaaggacacagtt
gaaaaggttcgccagacctttgagaactacgagatgaattccttcgaaattctgatgtac
aagaagaacaggacacctgtgtggttttttgtgaagatcgctccgatcaggaacgaacag
gataaagtggtcctgttcctttgcactttcagcgacataactgcattcaagcagcccatc
gaggacgactcctgcaaaggttgggggaagtttgcccgactgaccagagctctgacaagc
agcaggggagtcctgcagcagctggcccccagtgtacagaagggtgagaatgttcacaag
cactcgcgcctggcagaggtcctgcagctgggttcagacatccttccccagtacaagcaa
gaggcgccaaagacaccccctcacatcatcctacactactgtgtctttaagaccacgtgg
gattggatcatcttgatcctgaccttctacacagccatcttggtcccttacaacgtctcc
tttaaaaccaggcagaataatgtggcctggctggtggtggacagcatcgtggatgtcatc
tttttggtggacattgttttgaattttcacaccacctttgtcgggccagcgggggaagtg
atatctgaccccaaacttatccgcatgaactacctgaagacgtggtttgtgatcgacctt
ctgtcctgtttgccgtatgacgtcatcaacgcttttgagaacgtggatgaggttagtgcc
tttatgggtgatccagggaagattggttttgctgatcagatcccaccaccactggagggg
agagagagtcagggcatcagcagcctgttcagttctctgaaagttgtgcggctgctccgt
ctcgggcgagtggcccgcaaactggatcattacatcgagtatggagccgcggtactggtc
ctgttggtgtgcgtgtttgggcttgctgcccactggatggcctgcatctggtacagcatt
ggggactatgagatctttgatgaagacaccaagaccatccgcaacaacagctggctctac
caactggcattggacatcggcactccataccagtttaatgggtctggttcagggaagtgg
gaaggtgggccaagcaagaactctgtctacatctcctcgctgtacttcaccatgacaagt
ctcaccagtgtgggctttggtaacattgccccatccacagacatcgagaagatcttcgca
gtggccatcatgatgattggctctcttctgtatgccaccatctttgggaacgtgacaacc
attttccagcagatgtacgccaacaccaacaggtaccacgagatgctcaacagtgtccgg
gatttcctgaagctctaccaggtgcccaaagggctgagtgagcgggtcatggactacatt
gtgtccacctggtccatgtcccgaggcatcgacacagagaaggtcctgcagatctgcccc
aaggacatgcgagccgacatttgcgtgcacctgaaccgcaaagtgttcaaagaacaccct
gcctttcgattggccagcgatggctgcctgcgggccttggccatggagttccagacagtg
cactgtgccccaggggacctcatctatcatgctggagagagtgtggacagcctctgcttc
gtggtctcaggctccctggaggtgatccaggatgacgaggtggtggccatcctagggaaa
ggagacgtgtttggggatgttttctggaaggaagctacccttgcacagtcctgtgctaat
gtccgggccttgacctactgtgacctgcacgtgatcaagagggacgcccttcagaaagtg
ctagaattctacacagccttctcccactccttctcccggaacctgattctcacctacaac
ctgaggaagaggattgtgttccggaagatcagcgacgtgaaacgagaagaggaggagagg
atgaaacggaagaacgaggccccccttatcctgcctcctgaccaccccgtcagaagactc
ttccaaaggttccgccagcagaaagaagccaggctggcagccgagagagggggccgggac
ctggatgacctggatgtagaaaagggcaatgccctcacggaccatacctcagccaaccac
agcctggtgaaggccagtgtggtcacggtgcgtgagagccccgccacgcctgtgtccttc
caggcggccaccacctccaccatgtcagaccacgccaagctgcatgcccccggatctgag
tgcctaggtcccaaggcagtcagctgtgaccctgccaagcgcaaaggctgggcccgtttc
aaagatgcctgtggaaagggtgaggattggaacaaggtgtccaaggcagagtccatggag
acgctgcccgagaggacaaaggcaccgggtgaggccacgctgaagaagacagactcctgt
gacagcggaatcaccaagagcgacctgcgcttggacaatgtgggtgagaccaggagtcct
caggaccggagccccatcttggctgaggtcaagcattctttctaccccatccctgagcag
acgctgcaggccacagtgctggaggtgaaatatgagctgaaggaggatatcaaggccttg
aatgccaaaatgacctccattgagaagcagctgtctgagatactcaggatactaatgtcc
agagggtccgcccaatctcctcaggagacgggtgagatctccaggccccagtccccagag
tcagacagagacatttttggagcaagctga

DBGET integrated database retrieval system