KEGG   Mus musculus (house mouse): 16511
Entry
16511             CDS       T01002                                 
Symbol
Kcnh2, AI326795, ERG1, LQT, Lqt2, M-erg, Merg1, merg1a, merg1b
Name
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 2
  KO
K04905  potassium voltage-gated channel Eag-related subfamily H member 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16511 (Kcnh2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16511 (Kcnh2)
SSDB
Motif
Pfam: Ion_trans Ion_trans_2 cNMP_binding SSTK-IP
Other DBs
NCBI-GeneID: 16511
NCBI-ProteinID: NP_001281091
MGI: 1341722
Ensembl: ENSMUSG00000038319
Vega: OTTMUSG00000024115
UniProt: O35219 A0A0R4J1K0
Position
5:complement(24524583..24556671)
AA seq 820 aa
MAIPAGKESRTGALQPRAQKGRVRRAVRISSLVAQEVLSLGADVLPEYKLQAPRIHRWTI
LHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLKETEDGSQAPDCGYACQPLAVVDLIVD
IMFIVDILINFRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEEL
IGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMD
SHIGWLHNLGDQIGKPYNSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIF
SICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEY
FQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKT
THAPPGDTLVHAGDLLTALYFISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNG
DVRALTYCDLHKIHRDDLLEVLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSAELESG
FNRQRKRKLSFRRRTDKDTEQPGEVSALGQGPARVGPGPSCRGQPGGPWGESPSSGPSSP
ESSEDEGPGRSSSPLRLVPFSSPRPPGDPPGGEPLTEDGEKSDTCNPLSGAFSGVSNIFS
FWGDSRGRQYQELPRCPAPAPSLLNIPLSSPGRRSRGDVESRLDALQRQLNRLETRLSAD
MATVLQLLQRQMTLVPPAYSAVTTPGPGPTSASPLLPVGPVPTLTLDSLSQVSQFVAFEE
LPAGAPELPQDGPTRRLSLPGQLGALTSQPLHRHGSDPGS
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggcgattccagccgggaaggagagcaggacaggggctctgcagcccagggcccagaaa
ggccgggtgaggcgggcagtgcgcatctccagcctggtggcccaggaggtcctgtccttg
ggagcagatgtgctgcctgagtataagctgcaggccccaagaatccaccgctggaccatc
ctccactacagccccttcaaggcggtgtgggactggctcatcctgctgctggtcatctac
acggcagtcttcacaccgtactcggccgccttcctgctgaaggagactgaagatgggtcc
caagcccctgactgtggctacgcctgccagcccctggctgtagtggacctcatcgtggac
atcatgttcattgtggacatccttatcaatttccgtaccacctatgttaatgccaacgag
gaggtggttagccatcctggccgcattgctgtgcactacttcaagggctggtttctcatt
gacatggtggctgccatccccttcgacctgctcatctttggctctggctccgaggagctg
atcgggctgctgaaaactgcgaggctgctgcggctggtgcgcgtggctcggaagctggac
cgctactcggagtacggggcagcagtgctcttcctgctcatgtgcaccttcgccctcatt
gcgcactggttggcctgcatctggtacgcgatcggcaacatggaacagcctcacatggac
tcacacatcggctggctgcacaacttgggcgaccagatcggcaagccctacaacagcagc
ggcctgggaggcccctccatcaaggacaagtatgtcacagcgctctacttcaccttcagc
agcctcaccagcgtgggctttggcaatgtctctcccaacaccaactcagagaagatcttc
tccatctgtgtcatgctcattggctccctcatgtatgccagcatcttcggcaacgtgtcc
gccatcatccagcggctgtactcgggcacggcccgctaccacacacagatgctccgggtg
cgggagtttatccgctttcaccagattcccaacccattacgccagcgcctcgaggagtac
ttccagcatgcttggtcctacaccaatggcatcgacatgaacgcggtgctgaagggcttc
cctgagtgcctccaggctgacatctgcctacacctgaaccgctcgctgctgcagcattgc
aagccattccgaggggccactaaaggctgcctgagggcgctggctatgaagttcaagacc
acacatgcaccaccaggggacacactagtgcacgccggggacctgcttactgccctctac
ttcatctccaggggctccatcgagatcctgcggggtgatgtcgtggtggccatcttgggg
aagaacgacatctttggagagcctctgaacctatatgcccgtcctggaaagtccaatggg
gatgtgcgggccctcacgtactgtgacctgcacaagatccatcgtgatgacttgctggag
gtgttggacatgtatcccgagttctcagatcacttttggtctagcctggagatcaccttc
aaccttcgagataccaacatgattcctggctccccaggcagtgcagaactagagagcggc
tttaacaggcaacgcaagcgcaaactgtcattccgcaggcgtacagacaaggacacagag
cagccaggggaggtgtcagccctggggcaaggccctgcccgagttgggccagggccgagt
tgccggggacagccgggagggccatggggggagagcccatccagcggcccttccagccca
gagagcagtgaagatgagggccctggtcgcagctccagtcccctccgcctggtgcccttc
tccagccccaggcctccgggagaccccccaggtggggagcctttgacagaggatggggag
aaaagtgacacctgtaatcccttgtcaggtgccttctctggggtgtccaatattttcagc
ttctggggggacagtcgggggcgccagtaccaggagttgcctcgatgccctgcccctgcc
cccagcctcctcaacatccccttgtctagccctggtcggcgatcccggggtgatgtggag
agcaggctggacgcactccagagacagctgaacaggctggaaacccggctaagtgcagac
atggccactgtcctacagctgctacagaggcaaatgaccctggtccctcctgcctacagt
gctgtgaccacccctgggcccggccccacttccgcatcccctttgttgcctgtcggccct
gtccccactctcaccctggactcgctttctcaggtttcccagttcgtggcgtttgaggag
cttcctgcaggagccccagagctcccccaagatggccccactcgacgcctctccctgccc
ggccagctgggggcccttacctcccagcccctgcacagacatggctcagatccaggcagt
tag

DBGET integrated database retrieval system