KEGG   Mus musculus (house mouse): 16522
Entry
16522             CDS       T01002                                 
Symbol
Kcnj6, BIR1, GIRK2, KATP2, KCNJ7, Kir3.2, weaver, wv
Name
(RefSeq) potassium inwardly-rectifying channel, subfamily J, member 6
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04929  GnRH secretion
mmu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    16522 (Kcnj6)
   04915 Estrogen signaling pathway
    16522 (Kcnj6)
   04921 Oxytocin signaling pathway
    16522 (Kcnj6)
  09156 Nervous system
   04727 GABAergic synapse
    16522 (Kcnj6)
   04725 Cholinergic synapse
    16522 (Kcnj6)
   04728 Dopaminergic synapse
    16522 (Kcnj6)
   04726 Serotonergic synapse
    16522 (Kcnj6)
   04723 Retrograde endocannabinoid signaling
    16522 (Kcnj6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    16522 (Kcnj6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    16522 (Kcnj6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16522 (Kcnj6)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   16522 (Kcnj6)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans_2
Other DBs
NCBI-GeneID: 16522
NCBI-ProteinID: NP_034736
MGI: 104781
Ensembl: ENSMUSG00000043301
UniProt: P48542 Q0VB45 Q8C8Y6
Structure
Position
16:complement(94545839..94798719)
AA seq 425 aa
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR
GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE
NESKV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgacaatggccaagttaactgaatccatgactaacgtcttggaaggcgattccatggac
caggatgtggaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggac
gacctgccgagacacatcagccgagacaggaccaaaaggaaaatccagaggtacgtgagg
aaggatgggaagtgcaacgttcaccacggcaatgtgcgggagacgtaccgatacctgacg
gacatcttcaccaccctggtggacctgaagtggagattcaacctgttgatctttgtcatg
gtctacacagtgacgtggcttttctttgggatgatctggtggctgattgcgtacatccgg
ggagatatggaccacatagaggacccctcgtggactccttgtgtcaccaacctcaacggg
tttgtctctgcttttttattctccatagagacagaaaccaccatcggttatggctaccgg
gtcatcacggacaagtgccctgaggggattattctcctcttaatccagtccgtgttgggg
tccattgtcaacgccttcatggtaggatgtatgtttgtgaaaatatcccaacccaagaag
agggcagagaccctggtcttttccacccacgcggtgatctccatgcgggatgggaaactg
tgcttgatgttccgggtgggggacttgaggaattctcacattgtggaggcatccatcaga
gccaagttgatcaagtccaaacagacttcagagggggagtttattcccctcaaccagact
gatatcaacgtggggtactacacaggggacgaccggctctttctggtgtcaccattgatt
attagccatgaaattaaccaacagagtcccttctgggagatctccaaagcgcagctgcct
aaagaggaactggagattgtggtcatcctggagggaatggtggaagccacaggaatgacg
tgccaagcccgaagctcctacatcaccagtgagatcttgtggggttaccggttcacacct
gtcctaacgctggaagacgggttctacgaagttgactacaacagcttccatgagacctat
gagaccagcaccccgtcccttagtgccaaagagctagcggagctggctaaccgggcagag
ctgcctctgagttggtctgtgtccagcaaactgaaccaacatgcagaattggagacagaa
gaggaagagaagaacccggaagaactgacggagaggaatggtgacgtggcaaacctagag
aatgaatccaaagtatag

DBGET integrated database retrieval system