KEGG   Mus musculus (mouse): 16526Help
Entry
16526             CDS       T01002                                 

Gene name
Kcnk2, A430027H14Rik, AI848635, TREK-1
Definition
(RefSeq) potassium channel, subfamily K, member 2
  KO
K04913  potassium channel subfamily K member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    16526 (Kcnk2)
  09154 Digestive system
   04971 Gastric acid secretion
    16526 (Kcnk2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    16526 (Kcnk2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16526 (Kcnk2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   16526 (Kcnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 16526
NCBI-ProteinID: NP_001153322
MGI: 109366
Ensembl: ENSMUSG00000037624
Vega: OTTMUSG00000051040
UniProt: P97438 Q6P6P9
Structure
PDB: 

Position
1; 1 H6
AA seq 426 aa AA seqDB search
MLASASRERPGYTAGVAAPDLLDPKSAAQNSKPRLSFSSKPTVLASRVESDSAINVMKWK
TVSTIFLVVVLYLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQ
IVAAINAGIIPLGNSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALL
GIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVAL
PAVIFKHIEGWSALDAIYFVVITLTTIGFGDYVAGGSDIEYLDFYKPVVWFWILVGLAYF
AAVLSMIGDWLRVISKKTKEEVGEFRAHAAEWTANVTAEFKETRRRLSVEIYDKFQRATS
VKRKLSAELAGNHNQELTPCRRTLSVNHLTSEREVLPPLLKAESIYLNGLTPHCAGEDIA
VIENMK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccagcgcctcgcgggagagacccggctatactgcaggagtggcggcccctgac
ttgctggatcccaagtctgctgctcagaactccaaaccgaggctctcattctcctcaaaa
cccaccgtgcttgcttcccgggtggagagtgactcggccattaatgttatgaaatggaag
acagtctccacgattttcctggtggtcgtcctctacctgatcatcggagccacggtgttc
aaggcattggagcagcctcaggagatttcccagaggaccaccattgtgatccagaagcag
accttcatagcccagcatgcctgcgtcaactccaccgagctggacgaactcatccagcaa
atagtggcagcaataaacgcagggattatccccttaggaaacagctccaatcaagttagt
cactgggacctcggaagctctttcttctttgctggtactgttatcacaaccataggattt
ggaaacatctccccacgaactgaaggtggaaaaatattctgcatcatctatgccttgctg
ggaattcccctctttggctttctactggctggggttggtgatcagctaggaactatattt
ggaaaaggaattgccaaagtggaagacacatttattaagtggaatgttagtcagacgaag
attcgtatcatctccaccatcatcttcatcctgtttggctgtgtcctctttgtggctctc
cctgcggtcatattcaagcacatagaaggctggagcgccctggacgctatctattttgtg
gttatcactctgacgaccattggatttggagactacgtggcaggtggatcagacattgaa
tatctggacttctacaagcctgtggtgtggttctggatcctcgttgggctggcctacttt
gcagctgttctgagcatgattggggactggctacgggtgatctctaagaagacgaaggaa
gaggtgggagagttcagagcgcatgccgctgagtggacagccaatgtcacggccgagttc
aaggaaacgaggaggcggctgagcgtggagatctacgacaagttccagcgtgccacatcc
gtgaagcggaagctctccgcagagctggcgggcaaccacaaccaggaactgactccgtgt
aggaggaccctgtctgtgaaccacctgaccagcgagagggaagtcctgcctcccttgctg
aaggctgagagcatctatctgaacggtctgacaccacactgtgctggtgaggacatagct
gtcattgagaacatgaagtag

DBGET integrated database retrieval system