KEGG   Mus musculus (mouse): 16527
Entry
16527             CDS       T01002                                 

Gene name
Kcnk3, TASK, Task-1, cTBAK-1
Definition
(RefSeq) potassium channel, subfamily K, member 3
  KO
K04914  potassium channel subfamily K member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    16527 (Kcnk3)
   04927 Cortisol synthesis and secretion
    16527 (Kcnk3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    16527 (Kcnk3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16527 (Kcnk3)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   16527 (Kcnk3)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans
Other DBs
NCBI-GeneID: 16527
NCBI-ProteinID: NP_034738
MGI: 1100509
Ensembl: ENSMUSG00000049265
Vega: OTTMUSG00000054481
UniProt: O35111
Position
5 B1; 5 16.68 cM
AA seq 409 aa
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQLELRARYNLSEGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTFVRYLLHRAKRGLGMRHAEVSMANMVLIGFVSCISTLCIGAAAFSY
YERWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTHNGQAVGLGGLSCLSGSLGDGVRPRDPVTCAAAAG
GVGVGVGGSGFRNVYAEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEHSHS
SPGGGGRYSDTPSHPCLCSGTQRSAISSVSTGLHSLAAFRGLMKRRSSV
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaagcggcagaatgtgcgcacgttggctctcatcgtgtgcaccttcacctacctgctg
gtgggcgccgcggtgttcgacgcactggagtcggagccggagatgatcgagcggcagcgg
ctggagctgcggcagctggagctgcgggcgcgctacaacctcagcgagggcggctacgag
gagctggagcgcgtcgtgctgcgcctcaagccgcacaaggccggcgtgcagtggcgcttc
gccggctccttctacttcgccatcaccgtcatcaccaccatcggctatggtcatgcggcg
cccagcacggacggaggcaaggtgttctgcatgttctacgcgctgctgggcatcccgctc
acactagtcatgttccagagcctgggtgaacgcatcaacaccttcgtgaggtacctgctg
caccgtgccaagagggggctgggcatgcggcacgccgaggtgtccatggccaacatggtg
ctcatcggtttcgtgtcgtgcatcagcacgctgtgcatcggcgcagctgccttctcctac
tacgagcgctggactttcttccaggcctattactactgcttcatcaccctcaccaccatc
ggcttcggcgactatgtggcgctgcagaaggaccaggcgctgcagacgcagccgcagtat
gtggccttcagcttcgtgtacatcctcacgggcctcacggtcatcggcgccttcctcaac
ctcgtggtgctgcgattcatgaccatgaacgccgaggacgagaagcgtgatgcggagcac
cgcgccctgctcacgcacaacggccaggctgtcggcctgggtggcctgagctgcctgagc
ggtagcctgggcgacggcgtgcgtccccgcgacccagtcacatgcgctgcggccgcggga
ggcgtgggcgtgggcgtcggtggcagcggcttccgcaacgtctatgccgaggtgctgcac
ttccagtccatgtgctcgtgcctctggtacaagagccgcgagaagctgcagtactccatc
cccatgatcatcccgcgggacctctccacgtccgacacctgcgtggagcacagccactcg
tcgccgggaggcggcggccgctacagcgacacgccctcacacccctgcctgtgcagcggg
acgcagcgctcggccatcagctcggtgtccacgggcctgcacagcctggctgccttccgc
ggcctcatgaagcgcaggagctcggtgtga

DBGET integrated database retrieval system