KEGG   Mus musculus (mouse): 16533
Entry
16533             CDS       T01002                                 

Gene name
Kcnmb1, BKbeta1
Definition
(RefSeq) potassium large conductance calcium-activated channel, subfamily M, beta member 1
  KO
K04937  potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    16533 (Kcnmb1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    16533 (Kcnmb1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    16533 (Kcnmb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16533 (Kcnmb1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   16533 (Kcnmb1)
SSDB
Motif
Pfam: CaKB Arch_flagellin
Other DBs
NCBI-GeneID: 16533
NCBI-ProteinID: NP_112446
MGI: 1334203
Ensembl: ENSMUSG00000020155
Vega: OTTMUSG00000005401
UniProt: Q8CAE3 Q5SQK1
Position
11; 11 A4
AA seq 191 aa
MGKKLVMAQKRGETRALCLGVAMVVCAAITYYVLGTTVLPLYQKSVWTQESICHLIETNI
KDQEELEGKKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALADV
KKVRANFYKHHEFYCLSAPQVNETSVVYQRLYGPQVLLFSFFWPTFLLTGGLILIAMVKL
NRSLSILAAQK
NT seq 576 nt   +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcgcggagagacacgagccctctgcctggga
gtggcaatggtagtgtgtgctgccatcacctactacgtcctgggtacaactgtgctgccc
ctctaccagaaaagtgtgtggacccaggaatccatatgtcacttgattgaaactaatatc
aaggaccaggaagagctggagggcaagaaggtgccccagtacccatgcctttgggtcaat
gtatcagctgtgggcagatgggccatgctgtatcacacggaagacactcgggatcaaaac
caacagtgctcctatatccccaggaacctggacaactaccagacagccttggcagatgtg
aagaaggtcagagccaatttctataagcaccatgaattctattgcctttctgcacctcaa
gtcaacgagaccagcgtcgtgtaccagcgcctctacgggccccaagtcctcctcttctcc
ttcttctggcccaccttcctgctgaccgggggtcttattcttattgccatggtgaagctc
aacaggtccctatccatcttggcggctcagaagtag

DBGET integrated database retrieval system