KEGG   Mus musculus (house mouse): 16535
Entry
16535             CDS       T01002                                 
Symbol
Kcnq1, AW559127, KVLQT1, Kcna9
Name
(RefSeq) potassium voltage-gated channel, subfamily Q, member 1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04725  Cholinergic synapse
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    16535 (Kcnq1)
  09154 Digestive system
   04971 Gastric acid secretion
    16535 (Kcnq1)
   04972 Pancreatic secretion
    16535 (Kcnq1)
   04974 Protein digestion and absorption
    16535 (Kcnq1)
  09156 Nervous system
   04725 Cholinergic synapse
    16535 (Kcnq1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16535 (Kcnq1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16535 (Kcnq1)
SSDB
Motif
Pfam: Ion_trans KCNQ_channel Ion_trans_2 WDCP
Other DBs
NCBI-GeneID: 16535
NCBI-ProteinID: NP_032460
MGI: 108083
Ensembl: ENSMUSG00000009545
UniProt: P97414
Position
7:142660614..142980787
AA seq 668 aa
MDTASSPPSAERKRAGWSRLLGARRGSAVVKKCPFSLELAEGGPEGSTVYAPIAPTGAPG
LAPPMSTPVSPAPAPADLGPRPRVSLDPRVSIYSARRPLLARTHIQGRVYNFLERPTGWK
CFVYHFTVFLIVLVCLIFSVLSTIEQYAALATGTLFWMEIVLVVFFGTEYVVRLWSAGCR
SKYVGIWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHV
DRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVNESGRIEFGSYAD
ALWWGVVTVTTIGYGDKVPQTWVGKTIASCFSVFAISFFALPAGILGSGFALKVQQKQRQ
KHFNRQIPAAASLIQTAWRCYAAENPDSATWKIYVRKPARSHTLLSPSPKPKKSVMVKKK
KFKLDKDNGMSPGEKMFNVPHITYDPPEDRRPDHFSIDGYDSSVRKSPTLLEVSTPHFLR
TNSFAEDLDLEGETLLTPITHVSQLRDHHRATIKVIRRMQYFVAKKKFQQARKPYDVRDV
IEQYSQGHLNLMVRIKELQRRLDQSIGKPSLFIPISEKSKDRGSNTIGARLNRVEDKVTQ
LDQRLVIITDMLHQLLSMQQGGPTCNSRSQVVASNEGGSINPELFLPSNSLPTYEQLTVP
QTGPDEGS
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggacacggcctcgtccccgcccagtgctgaaaggaagcgcgcgggttggagccgcctg
ctaggcgcccggcggggcagcgcggtggtcaagaagtgtcccttctcactggagctggcc
gaaggtggccctgagggcagcacggtctatgcgcccatcgcgccaaccggagcccccggg
ctcgcgccccccatgtcgaccccagtgtcgcccgccccggcccctgcagacctcggccca
cgtccgcgggtgagccttgacccgcgggtctccatctacagtgcgcgccgcccgctgctg
gcgcgcacccacatccagggccgagtctacaacttcctcgagcgccccacgggttggaag
tgtttcgtgtaccacttcaccgtcttcctcattgttctggtctgcctcatcttcagtgtc
ctgtccactattgagcagtatgccgctctggccaccgggaccctcttctggatggagatt
gtccttgtggtgttctttgggacagaatatgtggtccgcctctggtctgcaggctgccgc
agcaagtacgtgggcatctggggccggctacgttttgcccggaagcccatttccatcatt
gacctcatcgtggttgtagcctctatggttgtcctctgcgtgggttccaaaggacaagtg
ttcgccacatcagctatcaggggtatccgcttccttcagatcctgcggatgctgcatgtc
gatcgccaggggggtacctggaggctcctgggctctgtagtcttcattcaccgccaggag
ctgatcaccaccctgtacattggctttctgggccttatcttctcctcctactttgtctac
ttggctgagaaagatgcggtgaacgagtccggccgcatcgagtttggcagctacgcagat
gctctgtggtggggggtggtcacagtcactaccattggctacggggataaggtacctcag
acgtgggttgggaagaccatcgcctcctgtttctctgtcttcgccatatccttctttgca
ctcccagcggggatacttggctctgggttcgcgctgaaggtccagcagaagcagaggcag
aagcacttcaaccggcagatcccagctgcagcctcactcatccagactgcatggaggtgc
tatgccgctgagaaccctgactcagccacttggaagatctatgtccggaagcctgctcgg
agtcacacgcttctgtcccccagccccaaacctaaaaagtctgtcatggtaaagaagaag
aagttcaagctggataaggataatgggatgagtcctggagagaagatgttcaatgttcct
cacatcacttatgatcccccagaggataggaggccagaccatttctccattgatggctat
gacagctcagtaaggaagagccctacactgctggaagtaagcacaccccatttcttgaga
acaaacagctttgcagaggacctggacctggaaggggagacactgctgacccccatcacc
catgtgtcacagctgcgggatcaccatcgggccaccatcaaggtcatcaggcgcatgcag
tactttgtagccaagaagaaattccagcaagcacggaagccctacgacgtgcgagatgtc
atcgagcagtactcccagggccacctgaaccttatggtgcgcattaaagaactacagaga
aggctggatcagtccattgggaagccatctttgttcatccccatctcagaaaagagcaaa
gaccgtggcagtaacaccatcggtgcccgtctgaacagggtggaagacaaggtgacacaa
ctggaccagagactggtgatcatcacagacatgctccaccagctgctgtccatgcaacaa
ggtggtccaacctgcaacagcaggtcacaagttgtagccagcaatgaaggtggctccatc
aaccctgagctcttcctacccagcaacagcctgcccacctacgaacaactgactgtgccc
cagacaggccctgatgagggttcctga

DBGET integrated database retrieval system