KEGG   Mus musculus (mouse): 16536
Entry
16536             CDS       T01002                                 

Symbol
Kcnq2, HNSPC, KQT2, Nmf134
Name
(RefSeq) potassium voltage-gated channel, subfamily Q, member 2
  KO
K04927  potassium voltage-gated channel KQT-like subfamily member 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    16536 (Kcnq2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    16536 (Kcnq2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   16536 (Kcnq2)
SSDB
Motif
Pfam: KCNQ_channel KCNQC3-Ank-G_bd KCNQ2_u3 Ion_trans Ion_trans_2 DUF6526 ABC2_membrane_5
Other DBs
NCBI-GeneID: 16536
NCBI-ProteinID: NP_001289817
MGI: 1309503
Ensembl: ENSMUSG00000016346
Vega: OTTMUSG00000016558
UniProt: Q9Z351
Position
2 H4; 2 103.57 cM
AA seq 851 aa
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVS
LKDRVFSSPRGMAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRTRQAFRI
KGAASRQNSEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKES
LRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPTITDKDRTKGPAETELPEDPS
MMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSRD
HADKHGCIIKIVRSTSSTGQRNYAAPPAIPPAQCPPSTSWQQSHQRHGTSPVGDHGSLVR
IPPPPAHERSLSAYGGGNRASTEFLRLEGTPACRPSEAALRDSDTSISIPSVDHEELERS
FSGFSISQSKENLDALGSCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSATGEGP
FGDVAWAGPRK
NT seq 2556 nt   +upstreamnt  +downstreamnt
atggtgcagaagtcgcgcaacggtggcgtgtaccccggcaccagcggggaaaagaagctc
aaggtgggcttcgtggggctggaccccggcgcgcccgactccacacgcgacggcgcgcta
ctcatcgcgggctccgaggcccccaagcgcggcagcgttttgagcaagccgcggacgggc
ggcgcgggagccgggaagcccccgaagcgcaacgccttctaccgcaagctgcagaatttc
ctctacaacgtgctagagcggccccgcggctgggcgttcatctaccacgcctacgtgttc
cttttagtcttctcctgccttgtgctttctgtgttttccaccatcaaggagtacgagaag
agctctgagggggccctctacatcttggaaatcgtgactatcgtggtattcggtgttgag
tactttgtgaggatctgggctgcaggctgctgttgccggtatcgaggctggaggggcagg
ctcaagtttgccaggaagccgttctgtgtgattgatatcatggtgctgattgcctccatt
gctgtgctggctgctggttcccagggcaatgtctttgccacatctgcgcttcggagcttg
cggttcttgcaaatcttgcggatgatccgtatggaccggaggggtggcacctggaagctc
ttgggatcggtagtctacgctcacagcaaggagctggtgactgcctggtacattggcttc
ctctgcctcatcctggcctcatttctggtgtacttggcagaaaagggtgagaatgaccac
tttgacacctacgcagatgcactctggtggggtctgatcaccctgacgaccattggctac
ggggacaagtaccctcagacctggaacgggaggctgctggcagcgacctttaccctcatt
ggtgtctcgttctttgctcttcctgctggcattttgggatccggctttgccctgaaagtc
caagagcagcatcggcaaaaacactttgagaaacggcggaaccctgcggcaggtctgatc
cagtctgcctggagattctatgctactaacctctcacgcaccgacctgcactccacgtgg
cagtactacgagcggacagtcactgtccccatgtacagctcacaaactcaaacctatggg
gcctccagactcatcccacctctgaaccagctggagctgctgaggaatctcaagagcaaa
tctggactcaccttcaggaaggagccacagccagagccatcaccaagtcagaaggtcagt
ttgaaagatcgtgtcttctccagcccccgaggcatggctgccaagggaaaggggtctccc
caggcccagacggtccggcggtcccccagtgcggatcagagtcttgatgacagcccgagc
aaggtgcccaagagctggagctttggtgaccgcagccgcacacgccaggctttccgcatc
aagggtgctgcatcccggcagaattcagaagcaagcctccctggggaggacatcgtagag
gacaacaagagctgtaactgcgagtttgtgactgaagatcttacccctggcctcaaagtt
agcatcagagctgtgtgtgttatgcggttcttggtatctaagcgaaagttcaaagagagt
ctgcgcccatatgatgtgatggacgtcatcgaacagtactcggctggacacttggatatg
ttgtcccgcatcaagagcctgcagtccagagtggaccagattgtggggcggggcccaaca
ataacggataaggaccgcaccaaaggcccagcggaaacggagctgcccgaagaccccagc
atgatgggacggcttgggaaggtggagaaacaggtcttgtccatggaaaagaagctcgac
ttcttggtgagcatctatacacagagaatgggcatcccaccagcagagacagaggcctat
tttggggccaaggagcctgagccggcaccaccctaccacagcccagaggacagccgtgac
catgcagacaagcatggctgtatcattaagatcgtccgctccaccagctctacgggccag
aggaactacgcagcacccccagccatcccccctgcccagtgtcctccctccacctcgtgg
cagcagagccaccagcgccatggcacctcccctgtgggagaccatggctcactggtacgc
atcccaccaccccctgcacacgagcggtcgctgtctgcctacggtgggggcaacagagcc
agtaccgagttcttgaggctggagggcaccccagcctgcaggccctctgaggctgccctg
cgggatagcgacacgtccatctccatcccttcggtggaccatgaggagctggagcgctcc
ttcagcggcttcagtatctcccagtccaaggagaacctggatgccctgggcagctgttat
gcagctgtggcaccatgcgccaaggtcaggccctacattgcagagggagagtctgacaca
gactcagacctctgcacaccatgtgggcctcccccacgctctgccactggtgagggcccc
tttggagatgtggcttgggcagggcccaggaaatga

DBGET integrated database retrieval system